Record in detail


General Info

  • lamp_id:L04ABAC101
  • Name:O34017_ENTFC
  • FullName:
  • Source:Enterococcus faecium
  • Mass:5465.2 Da
  • Sequence Length:53 aa
  • Isoelectric Point:9.43
  • Activity:Antimicrobial
  • Sequence
        ENDHRMPNELNRPNNLSKGGAKCGAAIAGGLFGIPKGPLAWAAGLANVYSKCN
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  6622
  •   2  Database:dbAMP  dbAMP_01468
  •   3  Database:Uniprot  O34017
  •   4  Database:BAC  BAC101
  •   5  Database:RAP  RAPD0052

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08958|    From 19 To 71 E-value: 1e-26 Score: 110
        ENDHRMPNELNRPNNLSKGGAKCGAAIAGGLFGIPKGPLAWAAGLANVYSKCN
  • 2. L04ABAC101    From 1 To 53 E-value: 4e-26 Score: 108
        ENDHRMPNELNRPNNLSKGGAKCGAAIAGGLFGIPKGPLAWAAGLANVYSKCN
  • 3. L01A002785    From 1 To 53 E-value: 2e-25 Score: 105
        ENDHRMPNNLNRPNNLSKGGAKCGAAIAGGLFGIPKGPLAWAAGLANVYSKCN
  • 4. L13A028069    From 1 To 50 E-value: 2e-23 Score: 99.8
        ENDHRMPNNLNRPNNLSKGGAKCGAAIAGGLFGIPKGPLAWAAGLANVYS
  • 5. L12A01471|    From 1 To 28 E-value: 0.0000000001 Score: 57
        ENDHRMPYELNRPNNLSKGGAKCGAAIA

Structure

  •   Domains
  •   1  Name:Bacteriocin_signal_motif    Interpro Link:IPR010133
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Holzapfel W.H.,Schillinger U.,Quadri L.E.,Worobo R.W.,Franz C.M.,
  •   Title:Atypical genetic locus associated with constitutive production of enterocin B by Enterococcus faecium BFE 900.
  •   Journal:Appl. Environ. Microbiol., 1999, 65, 2170-2178  [MEDLINE:99240446]
  •   [2]  Sonomoto K.,Nakayama J.,Zendo T.,Malaphan W.,Hu C.-B.,
  •   Title:Enterocin X, a novel two-peptide bacteriocin from Enterococcus faecium KU-B5, has an antibacterial spectrum entirely different from those of its component peptides.
  •   Journal:Appl. Environ. Microbiol., 2010, 76, 4542-4545  [PubMed:20418437]
  •   [3]  Hernandez P.E.,Nes I.F.,Cintas L.M.,Nilsen T.,Casaus P.,
  •   Title:Enterocin B, a new bacteriocin from Enterococcus faecium T136 which can act synergistically with enterocin A.
  •   Journal:Microbiology, , 143, 0-0  [MEDLINE:97388583]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: