Record in detail


General Info

  • lamp_id:L04ABAC102
  • Name:LCNA_LACLC
  • FullName:Bacteriocin lactococcin-A
  • Source:Lactococcus lactis subsp. cremoris
  • Mass:5778.4 Da
  • Sequence Length:54 aa
  • Isoelectric Point:8.97
  • Activity:Antimicrobial
  • Sequence
        KLTFIQSTAAGDLYYNTNTHKYVYQQTQNAFGAAANTIVNGWMGGAAGGFGLHH
  • Function:Kills Lactococci.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08164|    From 22 To 75 E-value: 6e-27 Score: 111
        KLTFIQSTAAGDLYYNTNTHKYVYQQTQNAFGAAANTIVNGWMGGAAGGFGLHH
  • 2. L04ABAC102    From 1 To 54 E-value: 2e-26 Score: 109
        KLTFIQSTAAGDLYYNTNTHKYVYQQTQNAFGAAANTIVNGWMGGAAGGFGLHH
  • 3. L13A018934    From 1 To 50 E-value: 7e-24 Score: 100
        KLTFIQSTAAGDLYYNTNTHKYVYQQTQNAFGAAANTIVNGWMGGAAGGF
  • 4. L12A06771|    From 20 To 65 E-value: 0.0003 Score: 35.8
        IWAVGPGLYQRDTETGKYRWIQTQDNLSYTTNVIANGWAGSAAGGY
  • 5. L12A06770|    From 38 To 70 E-value: 0.05 Score: 28.5
        KYVYRVTKDPVSAVFGVISNGWG-SAGAGFGPQH

Structure

  •   Domains
  •   1  Name:Bacteriocin_IId    Interpro Link:IPR007464
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Nes I.F.,Nilssen O.,Holo H.,
  •   Title:Lactococcin A, a new bacteriocin from Lactococcus lactis subsp. cremoris: isolation and characterization of the protein and its gene.
  •   Journal:J. Bacteriol., 1991, 173, 3879-3887  [MEDLINE:91267955]
  •   [2]  Venema G.,Kok J.,Jeeninga R.E.,Hayema B.J.,van Belkum M.J.,
  •   Title:Organization and nucleotide sequences of two lactococcal bacteriocin operons.
  •   Journal:Appl. Environ. Microbiol., 1991, 57, 492-498  [MEDLINE:91197113]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: