Record in detail


General Info

  • lamp_id:L04ABAC112
  • Name:Q7WRX6_9LACO
  • FullName:
  • Source:Lactobacillus gasseri
  • Mass:4777.4 Da
  • Sequence Length:48 aa
  • Isoelectric Point:9.97
  • Activity:Antimicrobial
  • Sequence
        NKWGNAVIGAATGATRGVSWCRGFGPWGMTACALGGAAIGGYLGYKSN
  • Function:null

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A06314|    From 18 To 65 E-value: 2e-22 Score: 95.9
        NKWGNAVIGAATGATRGVSWCRGFGPWGMTACALGGAAIGGYLGYKSN
  • 2. L04ABAC112    From 1 To 48 E-value: 6e-22 Score: 94.4
        NKWGNAVIGAATGATRGVSWCRGFGPWGMTACALGGAAIGGYLGYKSN
  • 3. L12A08084|    From 15 To 62 E-value: 0.000000000002 Score: 62.4
        NRWGDTVLSAASGAGTGIKACKSFGPWGMAICGVGGAAIGGYFGYTHN
  • 4. L02A001169    From 1 To 48 E-value: 0.000000000004 Score: 61.6
        NRWGDTVLSAASGAGTGIKACKSFGPWGMAICGVGGAAIGGYFGYTHN
  • 5. L12A09518|    From 19 To 66 E-value: 0.24 Score: 25.8
        NAPGDAVIGGLGGLASGLKFCKLPHPVLTGGCVVGFTVGGAYLGYTAN

Structure

  •   Domains
  •   1  Name:Bacteriocin_IIb_lactacin-rel    Interpro Link:IPR019493
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Rogelj I.,Matijasic B.B.,Allison G.E.,Venema K.,Majhenic A.C.,
  •   Title:DNA analysis of the genes encoding acidocin LF221 A and acidocin LF221 B, two bacteriocins produced by Lactobacillus gasseri LF221.
  •   Journal:Appl. Microbiol. Biotechnol., 2004, 63, 705-714  [PubMed:14504837]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: