Record in detail


General Info

  • lamp_id:L04ABAC113
  • Name:Q9KFM6_BACHD
  • FullName:
  • Source:Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
  • Mass:3065.5 Da
  • Sequence Length:30 aa
  • Isoelectric Point:7.12
  • Activity:Antimicrobial
  • Sequence
        GDVHAQTTWPCATVGVSVALCPTTKCTSQC
  • Function:null

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09585|    From 36 To 65 E-value: 0.0000000000006 Score: 64.7
        GDVHAQTTWPCATVGVSVALCPTTKCTSQC
  • 2. L04ABAC113    From 1 To 30 E-value: 0.000000000005 Score: 61.6
        GDVHAQTTWPCATVGVSVALCPTTKCTSQC
  • 3. L12A09465|    From 30 To 62 E-value: 0.0005 Score: 35
        GDPEARSGIPCTIGAAVAASIAVCPTTKCSKRC
  • 4. L12A08330|    From 35 To 72 E-value: 0.0008 Score: 34.3
        NDVNPETTPATTSSWTCITAGVTVSASLCPTTKCTSRC
  • 5. L12A08166|    From 33 To 69 E-value: 0.0008 Score: 34.3
        DVNPETTPATTSSWTCITAGVTVSASLCPTTKCTSRC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Sasaki R.,Maeno G.,Takaki Y.,Nakasone K.,Takami H.,
  •   Title:Complete genome sequence of the alkaliphilic bacterium Bacillus halodurans and genomic sequence comparison with Bacillus subtilis.
  •   Journal:Nucleic Acids Res., 2000, 28, 4317-4331  [MEDLINE:20512582]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: