Record in detail

lamp_id:L04ABAC119
Name:MCEA_KLEPN
FullName:Microcin E492
Source:Klebsiella pneumoniae
Mass:7886.5 Da
Sequence Length:84 aa
Isoelectric Point:3.7
Activity:Antimicrobial
Sequence
GETDPNTQLLNDLGNNMAWGAALGAPGGLGSAALGAAGGALQTVGQGLIDHGPVNVPIPVLIGPSWNGSGSGYNSATSSSGSGS
Function:Channel-forming bacteriocin. Forms cation-selective channels. Active on enterobacteria, with highest activity against E.coli. Not active on other Gram-negative bacteria, Gram-positive bacteria or fungi. The unmodified protein is active against E.coli and S.enteritidis. When the siderophore ester is present at Ser-99, antibacterial activity against these species is increased and activity is also detected against E.cloacae and K.pneumoniae.

Top similar AMPs on LAMP
1. L12A09009| From 16 To 99 E-value: 3.00004e-41 Score: 158
GETDPNTQLLNDLGNNMAWGAALGAPGGLGSAALGAAGGALQTVGQGLIDHGPVNVPIPVLIGPSWNGSGSGYNSATSSSGSGS
2. L04ABAC119 From 1 To 84 E-value: 7.00005e-41 Score: 157
GETDPNTQLLNDLGNNMAWGAALGAPGGLGSAALGAAGGALQTVGQGLIDHGPVNVPIPVLIGPSWNGSGSGYNSATSSSGSGS
3. L02A001196 From 1 To 84 E-value: 5e-40 Score: 154
GETDPNTQLLNDLGNNMAWGAALGAPGGLGSAALGAAGGALQTVGQGLIDHGPVNVFIPVLIGPSWNGSGSGYNSATSSSGSGS
4. L12A02492| From 1 To 80 E-value: 4e-39 Score: 151
GETDPNTQLLNDLGNNMAWGAALGAPGGLGSAALGAAGGALQTVGQGLIDHGPVNVPIPVLIGPSWNGSGSGYNSATSSS
5. L12A02490| From 1 To 80 E-value: 3e-38 Score: 148
GETDPNTQLLNDLGNNMAWGAALGAPGGLGSAALGAAGGALQTVGQGLIDHGPVNVFIPVLIGPSWNGSGSGYNSATSSS

Reference
[1] Monasterio O.,Cecchi X.,Vergara C.,Wilkens M.,Lagos R.,
Title:Microcin E492 forms ion channels in phospholipid bilayer membrane.
Journal:FEBS Lett., 1993, 321, 145-148 [MEDLINE:93238942]
[2] Monasterio O.,Villanueva J.E.,Lagos R.,
Title:Identification and properties of the genes encoding microcin E492 and its immunity protein.
Journal:J. Bacteriol., 1999, 181, 212-217 [MEDLINE:99084959]
[3] Van Dorsselaer A.,Delalande F.,Vignon D.,Zorn N.,Pons A.-M.,
Title:Microcin E492 is an unmodified peptide related in structure to colicin V.
Journal:Antimicrob. Agents Chemother., 2002, 46, 229-230 [PubMed:11751140]
[4] Barthelemy M.,Goulard C.,Santamaria M.,Thomas X.,Destoumieux-Garzon D.,
Title:Microcin E492 antibacterial activity: evidence for a TonB-dependent inner membrane permeabilization on Escherichia coli.
Journal:Mol. Microbiol., 2003, 49, 1031-1041 [PubMed:12890026]
[5] Blond A.,Afonso C.,Peduzzi J.,Destoumieux-Garzon D.,Thomas X.,
Title:Siderophore peptide, a new type of post-translationally modified antibacterial peptide with potent activity.
Journal:J. Biol. Chem., 2004, 279, 28233-28242 [PubMed:15102848]