Record in detail


General Info

  • lamp_id:L04ABAC159
  • Name:B3IUC6_9ENTE
  • FullName:
  • Source:Enterococcus durans
  • Mass:5227.9 Da
  • Sequence Length:54 aa
  • Isoelectric Point:8.23
  • Activity:Antimicrobial
  • Sequence
        ENDHRMPYELNRPNNLSKGGAKCAAGILGAGLGAVGGGPGGFISAGISAVLGCM
  • Function:null

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08985|    From 19 To 72 E-value: 4e-26 Score: 108
        ENDHRMPYELNRPNNLSKGGAKCAAGILGAGLGAVGGGPGGFISAGISAVLGCM
  • 2. L04ABAC160    From 19 To 72 E-value: 4e-26 Score: 108
        ENDHRMPYELNRPNNLSKGGAKCAAGILGAGLGAVGGGPGGFISAGISAVLGCM
  • 3. L04ABAC159    From 1 To 54 E-value: 1e-25 Score: 106
        ENDHRMPYELNRPNNLSKGGAKCAAGILGAGLGAVGGGPGGFISAGISAVLGCM
  • 4. L12A01471|    From 1 To 27 E-value: 0.0000000002 Score: 56.6
        ENDHRMPYELNRPNNLSKGGAKCGAAI
  • 5. L12A08958|    From 19 To 66 E-value: 0.0000000002 Score: 56.6
        ENDHRMPNELNRPNNLSKGGAKCGAAIAG-GLFGIPKGPLAW-AAGLANV

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Sonomoto K.,Nakayama J.,Zendo T.,Hu C.-B.,
  •   Title:Description of durancin TW-49M, a novel enterocin B-homologous bacteriocin in carrot-isolated Enterococcus durans QU 49.
  •   Journal:J. Appl. Microbiol., 2008, 105, 681-690  [PubMed:18397254]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: