Record in detail


General Info

  • lamp_id:L04ABAC190
  • Name:D7UP04_ENTFC
  • FullName:
  • Source:Enterococcus faecium
  • Mass:4067.7 Da
  • Sequence Length:37 aa
  • Isoelectric Point:10.48
  • Activity:Antimicrobial
  • Sequence
        IAPIIVAGLGYLVKDAWDHSDQIISGFKKGWNGGRRK
  • Function:null

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07978|    From 19 To 55 E-value: 6e-17 Score: 77.8
        IAPIIVAGLGYLVKDAWDHSDQIISGFKKGWNGGRRK
  • 2. L04ABAC190    From 1 To 37 E-value: 2e-16 Score: 76.3
        IAPIIVAGLGYLVKDAWDHSDQIISGFKKGWNGGRRK
  • 3. L11A009920    From 5 To 26 E-value: 0.0006 Score: 34.7
        IVGGLGFLAGDAWSHSDQISSG
  • 4. L13A020530    From 3 To 18 E-value: 8.9 Score: 20.8
        LRDIWDWSCEVLSDFK

Structure

  •   Domains
  •   1  Name:Bacteriocin_IIb_lactobn/cerein    Interpro Link:IPR023991
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Sonomoto K.,Nakayama J.,Zendo T.,Malaphan W.,Hu C.-B.,
  •   Title:Enterocin X, a novel two-peptide bacteriocin from Enterococcus faecium KU-B5, has an antibacterial spectrum entirely different from those of its component peptides.
  •   Journal:Appl. Environ. Microbiol., 2010, 76, 4542-4545  [PubMed:20418437]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: