Record in detail

lamp_id:L04ABAC196
Name:LANLA_BACLD
FullName:Lantibiotic lichenicidin A1
Source:Bacillus licheniformis (strain DSM 13 / ATCC 14580)
Mass:3376.9 Da
Sequence Length:32 aa
Isoelectric Point:7.91
Activity:Antimicrobial
Sequence
TITLSTCAILSKPLGNNGYLCTVTKECMPSCN
Function:Lanthionine-containing peptide antibiotic (lantibiotic) active on Gram-positive bacteria. The bactericidal activity of lantibiotics is based on depolarization of energized bacterial cytoplasmic membranes, initiated by the formation of aqueous transmembrane pores. When present individually, LchA1 exhibits activity towards L.lactis HP. When combined with LchA2, it displays activity towards a broad spectrum of non-pathogenic and pathogenic Gram-positive bacteria including strains of L.monocytogenes, methicillin-resistant S.aureus, S.pneumoniae and strains of vancomycin-resistant enterococci, but not towards E.faecium L4001 and BM4147-1. Combined LchA1 and LchA2 peptides also inhibit Bacillus sp. HIL-Y85/54728, L.lactis DPC3417 and B.halodurans C-125, which produce lantibiotics themselves. Inactivated by proteinase K and pronase E, but not by trypsin and chymotrypsin.

Top similar AMPs on LAMP
1. L12A09345| From 43 To 74 E-value: 0.00000000000009 Score: 67.4
TITLSTCAILSKPLGNNGYLCTVTKECMPSCN
2. L04ABAC196 From 1 To 32 E-value: 0.0000000000003 Score: 65.5
TITLSTCAILSKPLGNNGYLCTVTKECMPSCN
3. L12A12140| From 2 To 32 E-value: 0.000000000002 Score: 63.2
ITLSTCAILAKPLGNNGYLCTVTKECMPSCN
4. L02A001511 From 1 To 30 E-value: 0.000000000006 Score: 61.2
TITLSTCAILSKPLGNNGYLCTVTKECMPS
5. L12A08511| From 35 To 57 E-value: 0.000002 Score: 42.7
LSRLLGNNGRWCTITKECMPSCN

Reference
[1] Zaretsky E.J.,Brody-Karpin S.D.,Nelson B.A.,Ramaiya P.,Rey M.W.,
Title:Complete genome sequence of the industrial bacterium Bacillus licheniformis and comparisons with closely related Bacillus species.
Journal:Genome Biol., 2004, 5, 0-0 [PubMed:15461803]
[2] Maurer K.H.,Feesche J.,Steckel S.,Herzberg C.,Veith B.,
Title:The complete genome sequence of Bacillus licheniformis DSM13, an organism with great industrial potential.
Journal:J. Mol. Microbiol. Biotechnol., 2004, 7, 204-211 [PubMed:15383718]
[3] Ross R.P.,Hill C.,Cotter P.D.,Begley M.,
Title:Identification of a novel two-peptide lantibiotic, lichenicidin, following rational genome mining for LanM proteins.
Journal:Appl. Environ. Microbiol., 2009, 75, 5451-5460 [PubMed:19561184]
[4] Bierbaum G.,Sahl H.G.,Szekat C.,Josten M.,Dischinger J.,
Title:Production of the novel two-peptide lantibiotic lichenicidin by Bacillus licheniformis DSM 13.
Journal:PLoS ONE, 2009, 4, 0-0 [PubMed:19707558]