Record in detail


General Info

  • lamp_id:L05A00DEF7
  • Name:D106A_HUMAN
  • FullName:Beta-defensin 106
  • Source:Homo sapiens
  • Mass:7368.7 Da
  • Sequence Length:65 aa
  • Isoelectric Point:8.72
  • Activity:Antimicrobial
  • Sequence
        MRTFLFLFAVLFFLTPAKNAFFDEKCNKLKGTCKNNCGKNEELIALCQKSLKCCRTIQPCGSIID
  • Function:Has antibacterial activity.

Cross-Linking

  •   Cross-linking
  •   1  Database:dbAMP  dbAMP_09189
  •   2  Database:Uniprot  Q8N104
  •   3  Database:DEF  DEF7

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05A00DEF7    From 1 To 65 E-value: 6e-33 Score: 131
        MRTFLFLFAVLFFLTPAKNAFFDEKCNKLKGTCKNNCGKNEELIALCQKSLKCCRTIQPCGSIID
  • 2. L01A002536    From 1 To 45 E-value: 3e-21 Score: 92.4
        FFDEKCNKLKGTCKNNCGKNEELIALCQKSLKCCRTIQPCGSIID
  • 3. L12A00178|    From 1 To 46 E-value: 6e-21 Score: 91.3
        AFFDEKCDKLKGTCKNNCGKNEELIALCQKSLKCCRTIQPCGNIID
  • 4. L01A003437    From 1 To 45 E-value: 1e-20 Score: 90.1
        FFDEKCGKLKGTCKNNCGKNEELIALCQKSLKCCRTIQPCGSIID
  • 5. L12A01333|    From 2 To 46 E-value: 1e-20 Score: 90.1
        FFDEKCGKLKGTCKNNCGKNEELIALCQKSLKCCRTIQPCGSIID

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Jia H.P.,Walters J.D.,Bartlett J.A.,Mitros J.P.,Schutte B.C.,
  •   Title:Discovery of five conserved beta-defensin gene clusters using a computational search strategy.
  •   Journal:Proc. Natl. Acad. Sci. U.S.A., 2002, 99, 2129-2133  [MEDLINE:21843921]
  •   [2]  Tomita T.,Fukuhara S.,Makita R.,Nagase T.,Yamaguchi Y.,
  •   Title:Identification of multiple novel epididymis-specific beta-defensin isoforms in humans and mice.
  •   Journal:J. Immunol., 2002, 169, 2516-2523  [MEDLINE:22181517]
  •   [3]  Dorin J.R.,Rolfe M.,Semple C.A.M.,
  •   Title:Duplication and selection in the evolution of primate beta-defensin genes.
  •   Journal:Genome Biol., 2003, 4, 0-0  [MEDLINE:22619651]
  •   [4]  Wu R.,Zhao Y.H.,Chen Y.,Kao C.Y.,
  •   Title:ORFeome-based search of airway epithelial cell-specific novel human beta-defensin genes.
  •   Journal:Am. J. Respir. Cell Mol. Biol., 2003, 29, 71-80  [MEDLINE:22705149]
  •   [5]  
  •   Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  •   Journal:Genome Res., 2004, 14, 2121-2127  [PubMed:15489334]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: