Record in detail


General Info

  • lamp_id:L05A00DEF8
  • Name:D107A_HUMAN
  • FullName:Beta-defensin 107
  • Source:Homo sapiens
  • Mass:7095.5 Da
  • Sequence Length:63 aa
  • Isoelectric Point:8.81
  • Activity:Antimicrobial
  • Sequence
        MKIFVFILAALILLAQIFQARTAIHRALISKRMEGHCEAECLTFEVKIGGCRAELAPFCCKNR
  • Function:Has antibacterial activity (Potential).

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q8IZN7
  •   2  Database:DEF  DEF8

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05A00DEF8    From 1 To 63 E-value: 1e-31 Score: 126
        MKIFVFILAALILLAQIFQARTAIHRALISKRMEGHCEAECLTFEVKIGGCRAELAPFCCKNR
  • 2. L12A06097|    From 1 To 47 E-value: 5e-21 Score: 91.3
        LYLARTAIHRALICKRMEGHCEAECLTFEVKIGGCRAELAPFCCKNR
  • 3. L01A002535    From 1 To 41 E-value: 1e-19 Score: 87
        AIHRALISKRMEGHCEAECLTFEVKIGGCRAELAPFCCKNR
  • 4. L12A10783|    From 1 To 43 E-value: 1e-19 Score: 86.7
        RTAIHRALICKRMEGHCEAECLTFEAKIGGCRAELAPFCCKNR
  • 5. L12A10784|    From 1 To 42 E-value: 1e-19 Score: 86.7
        RTAIHRALICKRMEGHCEAECLTFEVKIGGCRAELAPFCCKN

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Jia H.P.,Walters J.D.,Bartlett J.A.,Mitros J.P.,Schutte B.C.,
  •   Title:Discovery of five conserved beta-defensin gene clusters using a computational search strategy.
  •   Journal:Proc. Natl. Acad. Sci. U.S.A., 2002, 99, 2129-2133  [MEDLINE:21843921]
  •   [2]  Dorin J.R.,Rolfe M.,Semple C.A.M.,
  •   Title:Duplication and selection in the evolution of primate beta-defensin genes.
  •   Journal:Genome Biol., 2003, 4, 0-0  [MEDLINE:22619651]
  •   [3]  
  •   Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  •   Journal:Genome Res., 2004, 14, 2121-2127  [PubMed:15489334]
  •   [4]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]
  •   [5]  Taudien S.,Asakawa S.,Zody M.C.,Mikkelsen T.S.,Nusbaum C.,
  •   Title:DNA sequence and analysis of human chromosome 8.
  •   Journal:Nature, 2006, 439, 331-335  [PubMed:16421571]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: