Record in detail


General Info

  • lamp_id:L05A0DEF21
  • Name:DB121_HUMAN
  • FullName:Beta-defensin 121
  • Source:Homo sapiens
  • Mass:8456.1 Da
  • Sequence Length:76 aa
  • Isoelectric Point:8.84
  • Activity:Antimicrobial
  • Sequence
        MKLLLLLLTVTLLLAQVTPVMKCWGKSGRCRTTCKESEVYYILCKTEAKCCVDPKYVPVKPKLTDTNTSLESTSAV
  • Function:Has antibacterial activity (Potential).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05A0DEF21    From 1 To 76 E-value: 8e-39 Score: 150
        MKLLLLLLTVTLLLAQVTPVMKCWGKSGRCRTTCKESEVYYILCKTEAKCCVDPKYVPVKPKLTDTNTSLESTSAV
  • 2. L12A08045|    From 1 To 76 E-value: 1e-38 Score: 149
        MKLLLLFLTVTLLLAQVTPVMKCWGKSGRCRTTCKESEVYYILCKTEAKCCVDPKYVPVKPKLTDTNTSLESTSAV
  • 3. L12A08047|    From 1 To 76 E-value: 2e-38 Score: 149
        MKLLLLLLTVTLLLAQVTPVMKCWGKSGRCRATCKESEVYYILCKTEAKCCVDPKYVPVKPKLTDTNTSLESTSAV
  • 4. L01A003723    From 1 To 61 E-value: 2e-31 Score: 125
        QVTPVMKCWGKSGRCRTTCKESEVYYILCKTEAKCCVDPKYVPVKPKLTDTNTSLESTSAV
  • 5. L01A003701    From 1 To 61 E-value: 8e-31 Score: 124
        QVTPVMKCWGKSGRCRTTCKESEVYYILCKTEAKCCVDPKYVPVKPKLTDRNTSLESTSAV

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Gilbert J.G.R.,Burton J.,Ashurst J.L.,Matthews L.H.,Deloukas P.,
  •   Title:The DNA sequence and comparative analysis of human chromosome 20.
  •   Journal:Nature, 2001, 414, 865-871  [MEDLINE:21638749]
  •   [2]  
  •   Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  •   Journal:Genome Res., 2004, 14, 2121-2127  [PubMed:15489334]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: