Record in detail


General Info

  • lamp_id:L05A0DEF24
  • Name:DB124_HUMAN
  • FullName:Beta-defensin 124
  • Source:Homo sapiens
  • Mass:4927.7 Da
  • Sequence Length:43 aa
  • Isoelectric Point:8.11
  • Activity:Antimicrobial
  • Sequence
        EFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPV
  • Function:Has antibacterial activity (Potential).

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q8NES8
  •   2  Database:DEF  DEF24

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003712    From 1 To 43 E-value: 2e-21 Score: 92.4
        EFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPV
  • 2. L05A0DEF24    From 1 To 43 E-value: 2e-21 Score: 92.4
        EFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPV
  • 3. L12A04032|    From 4 To 46 E-value: 6e-21 Score: 91.3
        EFKRCWKGQGACRTYCTRQETYMHLCPDASLCCLSYALKPPPV
  • 4. L12A01350|    From 1 To 43 E-value: 6e-21 Score: 91.3
        EFKRCWKGQGACRTYCTRQETYMHLCPDASLCCLSYALKPPPV
  • 5. L12A01351|    From 1 To 43 E-value: 6e-21 Score: 90.9
        EFKRCWKGQGACRTYCTRQETYMHLCPDASLCCLSYALKPPPV

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Gilbert J.G.R.,Burton J.,Ashurst J.L.,Matthews L.H.,Deloukas P.,
  •   Title:The DNA sequence and comparative analysis of human chromosome 20.
  •   Journal:Nature, 2001, 414, 865-871  [MEDLINE:21638749]
  •   [2]  Jia H.P.,Walters J.D.,Bartlett J.A.,Mitros J.P.,Schutte B.C.,
  •   Title:Discovery of five conserved beta-defensin gene clusters using a computational search strategy.
  •   Journal:Proc. Natl. Acad. Sci. U.S.A., 2002, 99, 2129-2133  [MEDLINE:21843921]
  •   [3]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: