Record in detail


General Info

  • lamp_id:L05A0DEF66
  • Name:Q20A05_CRAGI
  • FullName:
  • Source:Crassostrea gigas
  • Mass:4677.3 Da
  • Sequence Length:43 aa
  • Isoelectric Point:8.21
  • Activity:Antimicrobial
  • Sequence
        GFGCPGDQYECNRHCRSIGCRAGYCDAVTLWLRCTCTGCSGKK
  • Function:null

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05A0DEF66    From 1 To 43 E-value: 2e-20 Score: 89.7
        GFGCPGDQYECNRHCRSIGCRAGYCDAVTLWLRCTCTGCSGKK
  • 2. L05A0DEF33    From 1 To 43 E-value: 2e-17 Score: 79.3
        GFGCPRDQYKCNSHCQSIGCRAGYCDAVTLWLRCTCTDCNGKK
  • 3. L01A003100    From 1 To 43 E-value: 3e-16 Score: 75.5
        GFGCPGNQLKCNNHCKSISCRAGYCDAATLWLRCTCTDCNGKK
  • 4. L13A013236    From 1 To 43 E-value: 0.000000000000002 Score: 72.4
        GFCCPGNQLKCNNHCKSISCRAGYCDAATLWLRCTCTDCNGKK
  • 5. L13A026355    From 1 To 43 E-value: 0.00000000003 Score: 58.9
        GFGCPEDEYECHNHCKNSVGCRGGYCDAGTLRQRCTCYGCNQK

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Romestand B.,de Lorgeril J.,Desserre G.,Gueguen Y.,Gonzalez M.,
  •   Title:Molecular characterization of two isoforms of defensin from hemocytes of the oyster Crassostrea gigas.
  •   Journal:Dev. Comp. Immunol., 2007, 31, 332-339  [PubMed:16962661]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: