Record in detail


General Info

  • lamp_id:L05A0DEF83
  • Name:DFBC7_BOVIN
  • FullName:Beta-defensin C7
  • Source:Bos taurus
  • Mass:4207.1 Da
  • Sequence Length:38 aa
  • Isoelectric Point:10.74
  • Activity:Antimicrobial
  • Sequence
        GPLSCRRKGGICILIRCPGPMRQIGTCFGRPVKCCRSW
  • Function:Has bactericidal activity.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000070    From 16 To 53 E-value: 6e-17 Score: 77.8
        GPLSCRRKGGICILIRCPGPMRQIGTCFGRPVKCCRSW
  • 2. L05A0DEF83    From 1 To 38 E-value: 2e-16 Score: 75.9
        GPLSCRRKGGICILIRCPGPMRQIGTCFGRPVKCCRSW
  • 3. L12A09080|    From 23 To 60 E-value: 0.000000000000002 Score: 72.4
        GPLSCRRNGGVCIPIRCPGPMRQIGTCFGRPVKCCRSW
  • 4. L12A02357|    From 7 To 44 E-value: 0.000000000000003 Score: 72
        GPLSCRRNGGVCIPIRCPGPMRQIGTCFGRPVKCCRSW
  • 5. L01A000010    From 1 To 38 E-value: 0.000000000000004 Score: 71.6
        GPLSCRRNGGVCIPIRCPGPMRQIGTCFGRPVKCCRSW

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Erdjument-Bromage H.,Russell J.P.,Diamond G.,Clark D.P.,Tarver A.P.,
  •   Title:Enteric beta-defensin: molecular cloning and characterization of a gene with inducible intestinal epithelial cell expression associated with Cryptosporidium parvum infection.
  •   Journal:Infect. Immun., 1998, 66, 1045-1056  [MEDLINE:98147718]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: