Record in detail


General Info

  • lamp_id:L05A0DEF87
  • Name:DEFB1_CERER
  • FullName:Beta-defensin 1
  • Source:Cercopithecus erythrogaster
  • Mass:3871.5 Da
  • Sequence Length:35 aa
  • Isoelectric Point:8.38
  • Activity:Antimicrobial
  • Sequence
        DHYICVRSGGQCLYSACPIYTKIQGTCYHGKAKCC
  • Function:Has bactericidal activity (By similarity).

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q95M67
  •   2  Database:DEF  DEF87

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000292    From 33 To 67 E-value: 2e-16 Score: 75.9
        DHYICVRSGGQCLYSACPIYTKIQGTCYHGKAKCC
  • 2. L01A003000    From 1 To 35 E-value: 0.000000000000001 Score: 73.2
        DHYICVRSGGQCLYSACPIYTKIQGTCYHGKAKCC
  • 3. L05A0DEF87    From 1 To 35 E-value: 0.000000000000002 Score: 73.2
        DHYICVRSGGQCLYSACPIYTKIQGTCYHGKAKCC
  • 4. L03A000296    From 33 To 67 E-value: 0.000000000000002 Score: 72.8
        DHYNCVRSGGQCLYSACPIYTKIQGTCYHGKAKCC
  • 5. L03A000293    From 33 To 67 E-value: 0.000000000000002 Score: 72.8
        DHYNCVRSGGQCLYSACPIYTKIQGTCYHGKAKCC

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Spano A.,Cervella P.,Zuccon D.,Boniotto M.,Del Pero M.,
  •   Title:Beta-defensin 1 gene variability among non-human primates.
  •   Journal:Immunogenetics, 2002, 53, 907-913  [MEDLINE:21850507]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: