Record in detail


General Info

  • lamp_id:L05A0DEF89
  • Name:DEFB1_CHILA
  • FullName:Beta-defensin 1
  • Source:Chinchilla lanigera
  • Mass:5130.1 Da
  • Sequence Length:45 aa
  • Isoelectric Point:11.4
  • Activity:Antimicrobial
  • Sequence
        GIINTIQRYFCRVRGGRCAALTCLPRETQIGRCSVKGRKCCRTRK
  • Function:Has antibacterial activity against Gram-positive bacterium S.pneumoniae Serotype 14. Is also active against Gram-negative bacteria M.catarrhalis 1857, and non-typeable H.influenzae strains 86-028NP and 1128. Has antifungal activity against C.albicans. May have a role in maintaining sterility in the middle ear.

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  1481
  •   2  Database:dbAMP  dbAMP_03006
  •   3  Database:SATPdb  satpdb13003
  •   4  Database:Uniprot  P83943
  •   5  Database:DEF  DEF89

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000248    From 23 To 67 E-value: 1e-20 Score: 90.5
        GIINTIQRYFCRVRGGRCAALTCLPRETQIGRCSVKGRKCCRTRK
  • 2. L05A0DEF89    From 1 To 45 E-value: 3e-20 Score: 89
        GIINTIQRYFCRVRGGRCAALTCLPRETQIGRCSVKGRKCCRTRK
  • 3. L01A003036    From 1 To 45 E-value: 4e-16 Score: 75.1
        GIINTLQKYYCRVRGGRCAVLTCLPKEEQIGKCSTRGRKCCRRKK
  • 4. L03A000252    From 23 To 67 E-value: 6e-16 Score: 74.3
        GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
  • 5. L03A000247    From 23 To 67 E-value: 6e-16 Score: 74.3
        GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Bakaletz L.O.,Munson R.S. Jr.,Bevins C.L.,Wilk D.,Harris R.H.,
  •   Title:Identification and characterization of mucosal antimicrobial peptides expressed by the chinchilla (Chinchilla lanigera) airway.
  •   Journal:J. Biol. Chem., 2004, 279, 20250-20256  [PubMed:14996845]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: