Record in detail


General Info

  • lamp_id:L05A0DEF98
  • Name:DEF19_ARATH
  • FullName:Defensin-like protein 19
  • Source:Arabidopsis thaliana
  • Mass:8840.2 Da
  • Sequence Length:78 aa
  • Isoelectric Point:8.15
  • Activity:Antimicrobial
  • Sequence
        MASSYTLMLFLCLSIFLIASTEMMAVEGRICERRSKTWTGFCGNTRGCDSQCKRWERASHGACHAQFPGFACFCYFNC
  • Function:Confers broad-spectrum resistance to pathogens.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  P82787
  •   2  Database:DEF  DEF98

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05A0DEF98    From 1 To 78 E-value: 1.00053e-42 Score: 162
        MASSYTLMLFLCLSIFLIASTEMMAVEGRICERRSKTWTGFCGNTRGCDSQCKRWERASHGACHAQFPGFACFCYFNC
  • 2. L12A11410|    From 1 To 58 E-value: 4e-31 Score: 124
        TEMMAVEGRICERRSKTWTGFCGNTRGCDSQCKRWERASHGACHAQFPGFACFCYFNC
  • 3. L06AT00046    From 1 To 49 E-value: 1e-25 Score: 106
        ICERRSKTWTGFCGNTRGCDSQCKRWERASHGACHAQFPGFACFCYFNC
  • 4. L03A000092    From 5 To 80 E-value: 8e-16 Score: 73.9
        ASIIVLLFVALVVFAAFEEPTMVEAQKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC
  • 5. L01A002124    From 1 To 79 E-value: 0.000000000000001 Score: 73.6
        MAKFATIISLLFAALVLFAAFEAPTMVDARLCERPSGTWSGVCGNNNACRNQCRNLERAEHGSCNYVFPAHKCICYFPC

Structure

  •   Domains
  •   1  Name:Gamma-thionin    Interpro Link:IPR008176
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   3  Name:LMW_cysteine-rich    Interpro Link:IPR020191
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Kaul S.,Federspiel N.A.,Palm C.J.,Ecker J.R.,Theologis A.,
  •   Title:Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
  •   Journal:Nature, 2000, 408, 816-820  [MEDLINE:21016719]
  •   [2]  Cock J.M.,Dumas C.,Miege C.,Vanoosthuyse V.,
  •   Title:Two large Arabidopsis thaliana gene families are homologous to the Brassica gene superfamily that encodes pollen coat proteins and the male component of the self-incompatibility response.
  •   Journal:Plant Mol. Biol., 2001, 46, 17-34  [MEDLINE:21330246]
  •   [3]  Thevissen K.,Cammue B.P.,Thomma B.P.H.J.,
  •   Title:Plant defensins.
  •   Journal:Planta, 2002, 216, 193-202  [PubMed:12447532]
  •   [4]  Shinn P.,Chen H.,Dale J.M.,Lim J.,Yamada K.,
  •   Title:Empirical analysis of transcriptional activity in the Arabidopsis genome.
  •   Journal:Science, 2003, 302, 842-846  [MEDLINE:22954850]
  •   [5]  VandenBosch K.A.,Paape T.D.,Graham M.A.,Silverstein K.A.T.,
  •   Title:Genome organization of more than 300 defensin-like genes in Arabidopsis.
  •   Journal:Plant Physiol., 2005, 138, 600-610  [PubMed:15955924]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: