Record in detail

lamp_id:L05ADEF109
Name:GLL1_CHICK
FullName:Gallinacin-1
Source:Gallus gallus
Mass:4567.4 Da
Sequence Length:40 aa
Isoelectric Point:10.03
Activity:Antimicrobial
Sequence
GRKSDCFRKSGFCAFLKCPSLTLISGKCSRFYLCCKRIWG
Function:Has bactericidal activity. Potent activity against E.coli ML-35, L.monocytogenes EGD and C.albicans.

Top similar AMPs on LAMP
1. L03A000259 From 26 To 65 E-value: 2e-18 Score: 83.2
GRKSDCFRKSGFCAFLKCPSLTLISGKCSRFYLCCKRIWG
2. L05ADEF109 From 1 To 40 E-value: 9e-18 Score: 80.5
GRKSDCFRKSGFCAFLKCPSLTLISGKCSRFYLCCKRIWG
3. L01A000595 From 1 To 39 E-value: 4e-17 Score: 78.6
GRKSDCFRKSGFCAFLKCPSLTLISGKCSRFYLCCKRIW
4. L12A09054| From 26 To 65 E-value: 4e-17 Score: 78.2
GRKSDCFRKNGFCAFLKCPYLTLISGKCSRFHLCCKRIWG
5. L12A09056| From 26 To 65 E-value: 2e-16 Score: 76.3
GRKSDCFRKSGFCASLKCPYLTLISGKCSRFHLCCKRIWG

Reference
[1] Lee T.D.,Tan L.,Kokryakov V.N.,Swiderek K.M.,Harwig S.S.L.,
Title:Gallinacins: cysteine-rich antimicrobial peptides of chicken leukocytes.
Journal:FEBS Lett., 1994, 342, 281-285 [MEDLINE:94200386]
[2] Jackwood M.W.,Harmon B.G.,Brockus C.W.,
Title:Characterization of beta-defensin prepropeptide mRNA from chicken and turkey bone marrow.
Journal:Anim. Genet., 1998, 29, 283-289 [MEDLINE:98418188]
[3] Cheng J.-F.,Matsuda Y.,Ando J.,Hughes A.L.,Xiao Y.,
Title:A genome-wide screen identifies a single beta-defensin gene cluster in the chicken: implications for the origin and evolution of mammalian defensins.
Journal:BMC Genomics, 2004, 5, 56-56 [PubMed:15310403]
[4] James T.,Tierney J.,Gaines S.,Higgs R.,Lynn D.J.,
Title:Bioinformatic discovery and initial characterisation of nine novel antimicrobial peptide genes in the chicken.
Journal:Immunogenetics, 2004, 56, 170-177 [PubMed:15148642]
[5] Isobe N.,Nishibori M.,Subedi K.,Ohashi H.,Yoshimura Y.,
Title:Effects of age, egg-laying activity, and Salmonella-inoculation on the expressions of gallinacin mRNA in the vagina of the hen oviduct.
Journal:J. Reprod. Dev., 2006, 52, 211-218 [PubMed:16394622]
[6] Yoshimura Y.,Nishibori M.,Isobe N.,Subedi K.,
Title:Changes in the expression of gallinacins, antimicrobial peptides, in ovarian follicles during follicular growth and in response to lipopolysaccharide in laying hens (Gallus domesticus).
Journal:Reproduction, 2007, 133, 127-133 [PubMed:17244739]