Record in detail


General Info

  • lamp_id:L05ADEF128
  • Name:DEFL1_CENLL
  • FullName:Defensin-1
  • Source:Centruroides limpidus limpidus
  • Mass:3821.3 Da
  • Sequence Length:32 aa
  • Isoelectric Point:8.37
  • Activity:Antimicrobial
  • Sequence
        ACQFWSCNSSCISRGYRQGYCWGIQYKYCQCQ
  • Function:Antibacterial protein involved in the immune response to septic injury. When combined with 14.026 kDa and 14.059 kDa hemolymph antimicrobial peptides, it has a strong cooperative activity against the Gram-positive bacteria B.subtilis and S.aureus, and against the Gram-negative bacteria E.coli DH5-alpha and K.pneumoniae ATCC 138833. No detectable antibacterial activity when present alone. Has no hemolytic activity in human erythrocytes.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000127    From 25 To 56 E-value: 0.00000000000003 Score: 68.9
        ACQFWSCNSSCISRGYRQGYCWGIQYKYCQCQ
  • 2. L05ADEF128    From 1 To 32 E-value: 0.0000000000004 Score: 65.5
        ACQFWSCNSSCISRGYRQGYCWGIQYKYCQCQ
  • 3. L13A012049    From 17 To 43 E-value: 0.067 Score: 27.7
        DCNGECLLRGYKGGYCSGFANVNCWCE
  • 4. L03A000005    From 15 To 39 E-value: 0.089 Score: 27.3
        ACAAHCLSKGYRGGYCDG--KKVCNCR
  • 5. L05ADEF403    From 15 To 39 E-value: 0.16 Score: 26.6
        ACAAHCLAKGYRGGYCDG--RKVCNCR

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Scaloni A.,Diego-Garcia E.,D"Ambrosio C.,Garcia B.I.,Rodriguez De La Vega R.C.,
  •   Title:Antimicrobial peptide induction in the haemolymph of the Mexican scorpion Centruroides limpidus limpidus in response to septic injury.
  •   Journal:Cell. Mol. Life Sci., 2004, 61, 1507-1519  [PubMed:15197474]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: