Record in detail
General Info
- lamp_id:L05ADEF128
- Name:DEFL1_CENLL
- FullName:Defensin-1
- Source:Centruroides limpidus limpidus
- Mass:3821.3 Da
- Sequence Length:32 aa
- Isoelectric Point:8.37
- Activity:Antimicrobial
- Sequence
ACQFWSCNSSCISRGYRQGYCWGIQYKYCQCQ - Function:Antibacterial protein involved in the immune response to septic injury. When combined with 14.026 kDa and 14.059 kDa hemolymph antimicrobial peptides, it has a strong cooperative activity against the Gram-positive bacteria B.subtilis and S.aureus, and against the Gram-negative bacteria E.coli DH5-alpha and K.pneumoniae ATCC 138833. No detectable antibacterial activity when present alone. Has no hemolytic activity in human erythrocytes.
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ4501
- 2 Database:DBAASP 4611
- 3 Database:dbAMP dbAMP_00089
- 4 Database:DRAMP DRAMP03692
- 5 Database:SATPdb satpdb24595
- 6 Database:Uniprot Q6GU94
- 7 Database:DEF DEF128
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L03A000127 From 25 To 56 E-value: 0.00000000000003 Score: 68.9
ACQFWSCNSSCISRGYRQGYCWGIQYKYCQCQ - 2. L05ADEF128 From 1 To 32 E-value: 0.0000000000004 Score: 65.5
ACQFWSCNSSCISRGYRQGYCWGIQYKYCQCQ - 3. L13A012049 From 17 To 43 E-value: 0.067 Score: 27.7
DCNGECLLRGYKGGYCSGFANVNCWCE - 4. L03A000005 From 15 To 39 E-value: 0.089 Score: 27.3
ACAAHCLSKGYRGGYCDG--KKVCNCR - 5. L05ADEF403 From 15 To 39 E-value: 0.16 Score: 26.6
ACAAHCLAKGYRGGYCDG--RKVCNCR
Structure
- Domains
- 1 Name:Defensin_invertebrate/fungal Interpro Link:IPR001542
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Scaloni A.,Diego-Garcia E.,D"Ambrosio C.,Garcia B.I.,Rodriguez De La Vega R.C.,
- Title:Antimicrobial peptide induction in the haemolymph of the Mexican scorpion Centruroides limpidus limpidus in response to septic injury.
- Journal:Cell. Mol. Life Sci., 2004, 61, 1507-1519 [PubMed:15197474]
Comments
- Comments
No comments found on LAMP database