Record in detail


General Info

  • lamp_id:L05ADEF160
  • Name:DEFB9_MOUSE
  • FullName:Beta-defensin 9
  • Source:Mus musculus
  • Mass:7682.1 Da
  • Sequence Length:67 aa
  • Isoelectric Point:8.66
  • Activity:Antimicrobial
  • Sequence
        MRTLCSLLLICCLLFSYTTPAANSIIGVSEMERCHKKGGYCYFYCFSSHKKIGSCFPEWPRCCKNIK
  • Function:Has antibacterial activity (By similarity).

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q8R2I6
  •   2  Database:DEF  DEF160

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF160    From 1 To 67 E-value: 3e-35 Score: 138
        MRTLCSLLLICCLLFSYTTPAANSIIGVSEMERCHKKGGYCYFYCFSSHKKIGSCFPEWPRCCKNIK
  • 2. L01A003015    From 1 To 43 E-value: 2e-21 Score: 92.4
        IIGVSEMERCHKKGGYCYFYCFSSHKKIGSCFPEWPRCCKNIK
  • 3. L05ADEF378    From 1 To 68 E-value: 0.000000006 Score: 51.2
        MRTLCSLLLIGCLLFSYATPVAG-ILGPLRIQTDYHRCLREKGFCLNAVCPRSTLFVGTCFPYKFYCCK
  • 4. L03A000282    From 1 To 71 E-value: 0.000000007 Score: 50.8
        MRTLCSLLLICCLLFSYTTPAVGSLKSIGYEAELDHCHTNGGYCVRAICPPSARRPGSCFPEKNPCCKYMK
  • 5. L05ADEF161    From 1 To 71 E-value: 0.00000007 Score: 47.8
        MRTLCSLLLICCLLFSYTTPAVGDLKHLILKAQLTRCYKFGGFCHYNICPGNSRFMSNCHPENLRCCKNIK

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Dorin J.R.,Hill R.E.,Kilanowski F.M.,Semple C.A.M.,Morrison G.M.,
  •   Title:Signal sequence conservation and mature peptide divergence within subgroups of the murine beta-defensin gene family.
  •   Journal:Mol. Biol. Evol., 2003, 20, 460-470  [PubMed:12644567]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: