Record in detail


General Info

  • lamp_id:L05ADEF164
  • Name:DFB13_MOUSE
  • FullName:Beta-defensin 13
  • Source:Mus musculus
  • Mass:7520 Da
  • Sequence Length:64 aa
  • Isoelectric Point:9.15
  • Activity:Antimicrobial
  • Sequence
        MRIFSLIVAGLVLLIQLYPAWGTLYRRFLCKKMNGQCEAECFTFEQKIGTCQANFLCCRKRKEH
  • Function:Has antibacterial activity (By similarity).

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q8R2I4
  •   2  Database:DEF  DEF164

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF164    From 1 To 64 E-value: 1e-33 Score: 133
        MRIFSLIVAGLVLLIQLYPAWGTLYRRFLCKKMNGQCEAECFTFEQKIGTCQANFLCCRKRKEH
  • 2. L01A003013    From 1 To 42 E-value: 3e-20 Score: 89
        TLYRRFLCKKMNGQCEAECFTFEQKIGTCQANFLCCRKRKEH
  • 3. L05A00DEF8    From 1 To 63 E-value: 0.000000000001 Score: 63.5
        MKIFVFILAALILLAQIFQARTAIHRALISKRMEGHCEAECLTFEVKIGGCRAELAPFCCKNR
  • 4. L01A003681    From 1 To 44 E-value: 0.000000000004 Score: 61.6
        TLYRRFLCKKMKGRCETACLSFEKKIGTCRADLTPLCCKEKKKH
  • 5. L12A06097|    From 1 To 50 E-value: 0.0000000004 Score: 55.1
        LYLARTAIHRALICKRMEGHCEAECLTFEVKIGGCRAELAPFCCKNRKKH

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Dorin J.R.,Hill R.E.,Kilanowski F.M.,Semple C.A.M.,Morrison G.M.,
  •   Title:Signal sequence conservation and mature peptide divergence within subgroups of the murine beta-defensin gene family.
  •   Journal:Mol. Biol. Evol., 2003, 20, 460-470  [PubMed:12644567]
  •   [2]  Marquez G.,Martinez-A C.,Albar J.P.,Villares R.,Zaballos A.,
  •   Title:Identification on mouse chromosome 8 of new beta-defensin genes with regionally specific expression in the male reproductive organ.
  •   Journal:J. Biol. Chem., 2004, 279, 12421-12426  [PubMed:14718547]
  •   [3]  Goldstein S.,Zody M.C.,Hillier L.W.,Goodstadt L.,Church D.M.,
  •   Title:Lineage-specific biology revealed by a finished genome assembly of the mouse.
  •   Journal:PLoS Biol., 2009, 7, 0-0  [PubMed:19468303]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: