Record in detail


General Info

  • lamp_id:L05ADEF182
  • Name:DFB35_MOUSE
  • FullName:Beta-defensin 35
  • Source:Mus musculus
  • Mass:7396.8 Da
  • Sequence Length:63 aa
  • Isoelectric Point:8.41
  • Activity:Antimicrobial
  • Sequence
        MPQTFFVFCFLFFVFLQLFPGTGEIAVCETCRLGRGKCRRACIESEKIVGWCKLNFFCCRERI
  • Function:Has antibacterial activity (By similarity).

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q8R2I3
  •   2  Database:DEF  DEF182

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF182    From 1 To 63 E-value: 3e-31 Score: 125
        MPQTFFVFCFLFFVFLQLFPGTGEIAVCETCRLGRGKCRRACIESEKIVGWCKLNFFCCRERI
  • 2. L05ADEF163    From 38 To 85 E-value: 9e-20 Score: 87.4
        YSQSFPG-GEIAVCETCRLGRGKCRRTCIESEKIAGWCKLNFFCCRERI
  • 3. L01A003014    From 4 To 51 E-value: 2e-19 Score: 85.9
        YSQSFPG-GEIAVCETCRLGRGKCRRTCIESEKIAGWCKLNFFCCRERI
  • 4. L01A003485    From 1 To 40 E-value: 8e-18 Score: 80.9
        EIAVCETCRLGRGKCRRACIESEKIVGWCKLNFFCCRERI
  • 5. L01A003680    From 4 To 51 E-value: 5e-17 Score: 78.2
        YSQSFPG-GEFAVCETCRLGRGKCRRTCLDSEKIAGKCKLNFFCCRERI

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Dorin J.R.,Hill R.E.,Kilanowski F.M.,Semple C.A.M.,Morrison G.M.,
  •   Title:Signal sequence conservation and mature peptide divergence within subgroups of the murine beta-defensin gene family.
  •   Journal:Mol. Biol. Evol., 2003, 20, 460-470  [PubMed:12644567]
  •   [2]  Marquez G.,Martinez-A C.,Albar J.P.,Villares R.,Zaballos A.,
  •   Title:Identification on mouse chromosome 8 of new beta-defensin genes with regionally specific expression in the male reproductive organ.
  •   Journal:J. Biol. Chem., 2004, 279, 12421-12426  [PubMed:14718547]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: