Record in detail


General Info

  • lamp_id:L05ADEF188
  • Name:DEF5_PANTR
  • FullName:Defensin-5
  • Source:Pan troglodytes
  • Mass:10063.3 Da
  • Sequence Length:94 aa
  • Isoelectric Point:7.05
  • Activity:Antimicrobial
  • Sequence
        MRTIAILAAILLVALQAQAESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRIGHCTILESLSGVCEISGRLYRLCCR
  • Function:Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane. All DEFA5 peptides exert antimicrobial activities, but their potency is affected by peptide processing (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF188    From 1 To 94 E-value: 0 Score: 186
        MRTIAILAAILLVALQAQAESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRIGHCTILESLSGVCEISGRLYRLCCR
  • 2. L03A000275    From 1 To 94 E-value: 0 Score: 174
        MRTIAILAAILLVALQAQAESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR
  • 3. L12A09201|    From 1 To 94 E-value: 1.4013e-45 Score: 172
        MRTITILAAILLVALQAQAESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGPCTNRESLSGVCEISGRLYRFCCR
  • 4. L12A09198|    From 1 To 94 E-value: 8.00001e-41 Score: 157
        MRTIAILAAILLVALQAQAESLQERADEAATQKQSGEDNQDLAVSFAGNGLSTLRASDSQARSTCYCRIGLCAAIESYSGRCYISGRRYRLCCR
  • 5. L12A08310|    From 1 To 94 E-value: 1e-39 Score: 153
        MKTIAILAAILLVALQAQAESLQERADEAATQKQSGEDNQDLAVSFAGNGLSTLRASDSQARSTCYCRSGLCAAIESYSGRCYISGRRYRLCCR

Structure

  •   Domains
  •   1  Name:Alpha-defensin    Interpro Link:IPR016327
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   3  Name:Defensin_propep    Interpro Link:IPR002366
  •   4  Name:Mammalian_defensins    Interpro Link:IPR006081
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zhang G.,Hughes A.L.,Patil A.,
  •   Title:Rapid evolution and diversification of mammalian alpha-defensins as revealed by comparative analysis of rodent and primate genes.
  •   Journal:Physiol. Genomics, 2004, 20, 1-11  [PubMed:15494476]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: