Record in detail


General Info

  • lamp_id:L05ADEF202
  • Name:D105A_PANTR
  • FullName:Beta-defensin 105A
  • Source:Pan troglodytes
  • Mass:5854.7 Da
  • Sequence Length:52 aa
  • Isoelectric Point:8.03
  • Activity:Antimicrobial
  • Sequence
        AGLDFSQPFPSGEFAVCESCKLGRGKCRKECLENEKPDGNCRLNFLCCRQRI
  • Function:Has antimicrobial activity (By similarity).

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q5IAB6
  •   2  Database:DEF  DEF202

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05A00DEF6    From 27 To 78 E-value: 8e-26 Score: 107
        AGLDFSQPFPSGEFAVCESCKLGRGKCRKECLENEKPDGNCRLNFLCCRQRI
  • 2. L12A06323|    From 27 To 78 E-value: 8e-26 Score: 107
        AGLDFSQPFPSGEFAVCESCKLGRGKCRKECLENEKPDGNCRLNFLCCRQRI
  • 3. L12A06308|    From 27 To 78 E-value: 2e-25 Score: 106
        AGLDFSQPFPSGEFAVCESCKLGRGKCRKECLENEKPDGNCRLNFLCCRERI
  • 4. L05ADEF202    From 1 To 52 E-value: 3e-25 Score: 105
        AGLDFSQPFPSGEFAVCESCKLGRGKCRKECLENEKPDGNCRLNFLCCRQRI
  • 5. L12A02448|    From 44 To 95 E-value: 5e-25 Score: 104
        AGLDFSQPFPSGEFAVCESCKLRRGKCRKECLENEKPDGNCRLNFLCCRQRI

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]
  •   [2]  Eastwood H.,Kilanowski F.M.,Gautier P.,Maxwell A.,Semple C.A.M.,
  •   Title:The complexity of selection at the major primate beta-defensin locus.
  •   Journal:BMC Evol. Biol., 2005, 5, 32-32  [PubMed:15904491]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: