Record in detail


General Info

  • lamp_id:L05ADEF234
  • Name:DEF1_DERVA
  • FullName:Defensin
  • Source:Dermacentor variabilis
  • Mass:4231.8 Da
  • Sequence Length:38 aa
  • Isoelectric Point:9.18
  • Activity:Antimicrobial
  • Sequence
        GFGCPLNQGACHNHCRSIRRRGGYCSGIIKQTCTCYRN
  • Function:Antibacterial activity against Gram-positive and Gram-negative bacteria.

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  9760
  •   2  Database:dbAMP  dbAMP_02560
  •   3  Database:SATPdb  satpdb21822
  •   4  Database:Uniprot  Q86QI5
  •   5  Database:DEF  DEF234
  •   6  Database:DEF  DEF497
  •   7  Database:DEF  DEF534

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000241    From 37 To 74 E-value: 5e-18 Score: 81.6
        GFGCPLNQGACHNHCRSIRRRGGYCSGIIKQTCTCYRN
  • 2. L12A11860|    From 15 To 52 E-value: 9e-18 Score: 80.5
        GFGCPLNQGACHNHCRSIRRRGGYCSGIIKQTCTCYRN
  • 3. L05ADEF234    From 1 To 38 E-value: 3e-17 Score: 79
        GFGCPLNQGACHNHCRSIRRRGGYCSGIIKQTCTCYRN
  • 4. L12A01314|    From 14 To 51 E-value: 4e-17 Score: 78.6
        GFGCPLNQGACHRHCRSIRRRGGYCSGIIKQTCTCYRN
  • 5. L12A02558|    From 1 To 38 E-value: 2e-16 Score: 76.6
        GFGCPLNQGACHNHCRSIKRRGGYCSGIIKQTCTCYRK

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Hynes W.L.,Sonenshine D.E.,Johns R.,
  •   Title:Identification of a defensin from the hemolymph of the American dog tick, Dermacentor variabilis.
  •   Journal:Insect Biochem. Mol. Biol., 2001, 31, 857-865  [MEDLINE:21332638]
  •   [2]  Hynes W.L.,Ratzlaff R.E.,Sonenshine D.E.,Ceraul S.M.,
  •   Title:An arthropod defensin expressed by the hemocytes of the American dog tick, Dermacentor variabilis (Acari: Ixodidae).
  •   Journal:Insect Biochem. Mol. Biol., 2003, 33, 1099-1103  [PubMed:14563361]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: