Record in detail


General Info

  • lamp_id:L05ADEF260
  • Name:DEF3_ANOGA
  • FullName:Antimicrobial peptide defensin 3
  • Source:Anopheles gambiae
  • Mass:4240.8 Da
  • Sequence Length:41 aa
  • Isoelectric Point:7.03
  • Activity:Antimicrobial
  • Sequence
        LACVTNEGPKWANTYCAAVCHMSGRGAGSCNAKDECVCSMT
  • Function:Antibacterial peptide mostly active against Gram-positive bacteria with atypical up-regulation of expression.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q5TWR9
  •   2  Database:DEF  DEF260

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07809|    From 27 To 67 E-value: 3e-20 Score: 88.6
        LACVTNEGPKWANTYCAAVCHMSGRGAGSCNAKDECVCSMT
  • 2. L13A017688    From 5 To 45 E-value: 2e-19 Score: 86.7
        LACVTNEGPKWANTYCAAVCHMSGRGAGSCNAKDECVCSMT
  • 3. L05ADEF260    From 1 To 41 E-value: 2e-19 Score: 85.9
        LACVTNEGPKWANTYCAAVCHMSGRGAGSCNAKDECVCSMT
  • 4. L05ADEF555    From 1 To 38 E-value: 0.001 Score: 33.5
        VTCDLLSGIGWNHTFCAAHCIFKGYKGGACNSKGVCVC
  • 5. L03A000163    From 49 To 84 E-value: 0.005 Score: 31.6
        VEAKGVKLNDAACAAHCLFRGRSGGYCNGKRVCVCR

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Charlab R.,Sutton G.G.,Halpern A.,Subramanian G.M.,Holt R.A.,
  •   Title:The genome sequence of the malaria mosquito Anopheles gambiae.
  •   Journal:Science, 2002, 298, 129-149  [MEDLINE:22251359]
  •   [2]  Ribeiro J.M.,Arca B.,Lombardo F.,Pham V.M.,Calvo E.,
  •   Title:The sialotranscriptome of adult male Anopheles gambiae mosquitoes.
  •   Journal:Insect Biochem. Mol. Biol., 2006, 36, 570-575  [PubMed:16835022]
  •   [3]  Eggleston P.,Lehane M.J.,Hurd H.,Meredith J.M.,
  •   Title:The malaria vector mosquito Anopheles gambiae expresses a suite of larval-specific defensin genes.
  •   Journal:Insect Mol. Biol., 2008, 17, 103-112  [PubMed:18353100]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: