Record in detail


General Info

  • lamp_id:L05ADEF261
  • Name:Q5TRS4_ANOGA
  • FullName:
  • Source:Anopheles gambiae
  • Mass:3521 Da
  • Sequence Length:32 aa
  • Isoelectric Point:8.88
  • Activity:Antimicrobial
  • Sequence
        LTCTNPTCSAQCRGRGYRRGSCTIGRCFCSYV
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q5TRS4
  •   2  Database:DEF  DEF261

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF261    From 1 To 32 E-value: 0.0000000000005 Score: 65.1
        LTCTNPTCSAQCRGRGYRRGSCTIGRCFCSYV
  • 2. L05ADEF413    From 12 To 39 E-value: 0.11 Score: 27.3
        CNQKQCDADCVKKGYFGGLCTLTSCFCT
  • 3. L12A07775|    From 24 To 51 E-value: 0.34 Score: 25.4
        ACNDRDCSLDCIMKGYNTGSCVRGSCQC
  • 4. L13A023526    From 10 To 28 E-value: 0.44 Score: 25
        CLAHCLLRGYKRGFCTVKK
  • 5. L05ADEF491    From 13 To 41 E-value: 0.52 Score: 25
        VTPNDSVCAAHCLVKGYKGGSCKNKICHC

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Charlab R.,Sutton G.G.,Halpern A.,Subramanian G.M.,Holt R.A.,
  •   Title:The genome sequence of the malaria mosquito Anopheles gambiae.
  •   Journal:Science, 2002, 298, 129-149  [MEDLINE:22251359]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: