Record in detail


General Info

  • lamp_id:L05ADEF301
  • Name:GLL12_CHICK
  • FullName:Gallinacin-12
  • Source:Gallus gallus
  • Mass:7171.3 Da
  • Sequence Length:65 aa
  • Isoelectric Point:8.13
  • Activity:Antimicrobial
  • Sequence
        MRNLCFVFIFISLLAHGSTHGPDSCNHDRGLSRVGNCNPGEYLAKYCFEPVILCCKPLSPTPTKT
  • Function:Has bactericidal activity (By similarity).

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q6IV19
  •   2  Database:DEF  DEF301

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF301    From 1 To 65 E-value: 1e-34 Score: 136
        MRNLCFVFIFISLLAHGSTHGPDSCNHDRGLSRVGNCNPGEYLAKYCFEPVILCCKPLSPTPTKT
  • 2. L01A003416    From 1 To 46 E-value: 2e-22 Score: 96.7
        HGPDSCNHDRGLCRVGNCNPGEYLAKYCFEPVILCCKPLSPTPTKT
  • 3. L02A001324    From 1 To 45 E-value: 9e-22 Score: 94
        GPDSCNHDRGLCRVGNCNPGEYLAKYCFEPVILCCKPLSPTPTKT
  • 4. L12A04462|    From 1 To 46 E-value: 4e-20 Score: 88.2
        HGPDSCNHDRGLCRVGSCIPGEYLAKYCFEPVILCCKPLSSTPTKS
  • 5. L11A011161    From 1 To 45 E-value: 6e-20 Score: 87.8
        GPDSXNHDRGLCRVGNCNPGEYLAKYCFEPVILXCKPLSPTPTKT

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Cheng J.-F.,Matsuda Y.,Ando J.,Hughes A.L.,Xiao Y.,
  •   Title:A genome-wide screen identifies a single beta-defensin gene cluster in the chicken: implications for the origin and evolution of mammalian defensins.
  •   Journal:BMC Genomics, 2004, 5, 56-56  [PubMed:15310403]
  •   [2]  James T.,Tierney J.,Gaines S.,Higgs R.,Lynn D.J.,
  •   Title:Bioinformatic discovery and initial characterisation of nine novel antimicrobial peptide genes in the chicken.
  •   Journal:Immunogenetics, 2004, 56, 170-177  [PubMed:15148642]
  •   [3]  Yoshimura Y.,Nishibori M.,Isobe N.,Subedi K.,
  •   Title:Changes in the expression of gallinacins, antimicrobial peptides, in ovarian follicles during follicular growth and in response to lipopolysaccharide in laying hens (Gallus domesticus).
  •   Journal:Reproduction, 2007, 133, 127-133  [PubMed:17244739]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: