Record in detail


General Info

  • lamp_id:L05ADEF316
  • Name:Q95P88_MESMA
  • FullName:
  • Source:Mesobuthus martensii
  • Mass:4317.8 Da
  • Sequence Length:39 aa
  • Isoelectric Point:5.53
  • Activity:Antimicrobial
  • Sequence
        DKYCSENPLDCNEHCLKTKNQIGICHGANGNEKCSCMES
  • Function:null

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF316    From 1 To 39 E-value: 6e-18 Score: 81.3
        DKYCSENPLDCNEHCLKTKNQIGICHGANGNEKCSCMES
  • 2. L05ADEF442    From 1 To 36 E-value: 0.076 Score: 27.7
        RYCPRNPEACYNYCLRTGRPGGYC-GGRSRITCFCFR
  • 3. L05ADEF396    From 1 To 34 E-value: 0.12 Score: 26.9
        DLVCPDNPDNCIQQCVSKGAQGGYCT----NEKCTCYE
  • 4. L12A04351|    From 48 To 70 E-value: 0.22 Score: 26.2
        DCQRHCQSTEQKDGICHGM----KCKC
  • 5. L01A003100    From 4 To 38 E-value: 0.65 Score: 24.6
        CPGNQLKCNNHCKSISCRAGYCDAATLWLRCTCTD

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zeng X.,Jiang D.,Li W.,Zhu S.,
  •   Title:Evidence for the existence of insect defensin-like peptide in scorpion venom.
  •   Journal:IUBMB Life, 2000, 50, 57-61  [MEDLINE:20537957]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: