Record in detail


General Info

  • lamp_id:L05ADEF326
  • Name:Q32ZF4_RAT
  • FullName:
  • Source:Rattus norvegicus
  • Mass:10143.1 Da
  • Sequence Length:87 aa
  • Isoelectric Point:9.16
  • Activity:Antimicrobial
  • Sequence
        MRLYLLLSTLLFLLGLLPRVRSGLGAAETHCVNLQGICRRDICKLIEDEIGACRRRWKCCRLWWVLLPIPTPVIFSDYQEPLQTKMK
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:DRAMP  DRAMP03452
  •   2  Database:Uniprot  Q32ZF4
  •   3  Database:DEF  DEF326

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF326    From 1 To 87 E-value: 0 Score: 176
        MRLYLLLSTLLFLLGLLPRVRSGLGAAETHCVNLQGICRRDICKLIEDEIGACRRRWKCCRLWWVLLPIPTPVIFSDYQEPLQTKMK
  • 2. L12A06020|    From 20 To 91 E-value: 5e-28 Score: 114
        FFPAVRGGLGAAEGRCLNLSGVCRRDVCKVVEDQSGACRRRMKCCRAWWILVPIPTPLIMSDYQEPLKPKLK
  • 3. L12A03434|    From 1 To 65 E-value: 6e-28 Score: 114
        GLGAAEGHCLNLSGVCRRDVCKVVEDQIGACRRRMKCCRAWWILMPIPTPLIMSDYQEPLKPKLK
  • 4. L01A003710    From 1 To 65 E-value: 3e-27 Score: 112
        GLGPAEGHCLNLSGVCRRDVCKVVEDQIGACRRRMKCCRAWWILMPIPTPLIMSDYQEPLKRKLK
  • 5. L01A003711    From 1 To 65 E-value: 2e-25 Score: 105
        GLGPAEGHCLNLFGVCRTDVCNIVEDQIGACRRRMKCCRAWWILMPIPTPLIMSDYQEPLKPNLK

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Sodergren E.J.,Muzny D.M.,Metzker M.L.,Weinstock G.M.,Gibbs R.A.,
  •   Title:Genome sequence of the Brown Norway rat yields insights into mammalian evolution.
  •   Journal:Nature, 2004, 428, 493-521  [PubMed:15057822]
  •   [2]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: