Record in detail


General Info

  • lamp_id:L05ADEF329
  • Name:Q32ZF1_RAT
  • FullName:
  • Source:Rattus norvegicus
  • Mass:9807.9 Da
  • Sequence Length:84 aa
  • Isoelectric Point:10.18
  • Activity:Antimicrobial
  • Sequence
        MKLPVLFLLFCFLDLLKTVKAEMKDTLFCFLKKGKCRHVCMNVEKRVGPCTKLNANCCIFVRDMRAIIPEDQRTVSIKIRNKQN
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:DRAMP  DRAMP03455
  •   2  Database:Uniprot  Q32ZF1
  •   3  Database:DEF  DEF329

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF329    From 1 To 84 E-value: 1.96182e-44 Score: 169
        MKLPVLFLLFCFLDLLKTVKAEMKDTLFCFLKKGKCRHVCMNVEKRVGPCTKLNANCCIFVRDMRAIIPEDQRTVSIKIRNKQN
  • 2. L12A01463|    From 1 To 63 E-value: 7e-33 Score: 130
        EMKDTLFCFLKKGKCRHVCMNVEKRVGPCTKLNANCCIFVRDMRAIIPEDQRTVSIKIRNKQN
  • 3. L12A00408|    From 2 To 61 E-value: 0.000000000001 Score: 63.5
        MKDTYSCFIKKGKCRRACHDLETPVSFCTKLNANCCMEKSEVKLSIPEKQNAGNIRKGNK
  • 4. L12A11799|    From 1 To 41 E-value: 0.000000000006 Score: 61.2
        VKCAMKDTYSCFLKRGKCRHACHNFETPVGFCTKLNANCCM
  • 5. L12A11798|    From 1 To 39 E-value: 0.0000000004 Score: 55.1
        VKCAMKDTYSCFIMKGKCRHECHDFEKPIGFCTKLNANC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Sodergren E.J.,Muzny D.M.,Metzker M.L.,Weinstock G.M.,Gibbs R.A.,
  •   Title:Genome sequence of the Brown Norway rat yields insights into mammalian evolution.
  •   Journal:Nature, 2004, 428, 493-521  [PubMed:15057822]
  •   [2]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: