Record in detail


General Info

  • lamp_id:L05ADEF330
  • Name:Q32ZF2_RAT
  • FullName:
  • Source:Rattus norvegicus
  • Mass:8314.8 Da
  • Sequence Length:75 aa
  • Isoelectric Point:7.97
  • Activity:Antimicrobial
  • Sequence
        MDLHLLCLLLFLVTSLPEGYCVIGNSGVSFKPCTSEGGYCFFGCKLGWIWITYCNNIMSCCKKDTKHSLPQTKGV
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:DRAMP  DRAMP03454
  •   2  Database:Uniprot  Q32ZF2
  •   3  Database:DEF  DEF330

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF330    From 1 To 75 E-value: 6e-40 Score: 154
        MDLHLLCLLLFLVTSLPEGYCVIGNSGVSFKPCTSEGGYCFFGCKLGWIWITYCNNIMSCCKKDTKHSLPQTKGV
  • 2. L05A0DEF49    From 1 To 73 E-value: 1e-16 Score: 77
        MNLCLSALLFFLVILLPSGKGMFGNDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPPQAK
  • 3. L01A003690    From 1 To 52 E-value: 0.000000000007 Score: 61.2
        MFGNDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPPQAK
  • 4. L01A003689    From 1 To 52 E-value: 0.0000000001 Score: 57
        MFGNDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPLQAK
  • 5. L01A003112    From 7 To 39 E-value: 0.002 Score: 32.7
        PCIAQNGRCFTGICRYPYFWIGTCRNGKSCCRR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Sodergren E.J.,Muzny D.M.,Metzker M.L.,Weinstock G.M.,Gibbs R.A.,
  •   Title:Genome sequence of the Brown Norway rat yields insights into mammalian evolution.
  •   Journal:Nature, 2004, 428, 493-521  [PubMed:15057822]
  •   [2]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]
  •   [3]  Yao A.,Turner R.,Miller J.,Di Francesco V.,Florea L.,
  •   Title:Gene and alternative splicing annotation with AIR.
  •   Journal:Genome Res., 2005, 15, 54-66  [PubMed:15632090]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: