Record in detail


General Info

  • lamp_id:L05ADEF343
  • Name:Q32ZH1_RAT
  • FullName:
  • Source:Rattus norvegicus
  • Mass:9577.3 Da
  • Sequence Length:83 aa
  • Isoelectric Point:8.6
  • Activity:Antimicrobial
  • Sequence
        MRLLLMALPLLALLPQVIPDYSAEKRCLNRLGHCKRKCKAGEMVMETCKYFQVCCVLDDNDYKQKASITRTMEKTSTIEYNLS
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:DRAMP  DRAMP03439
  •   2  Database:Uniprot  Q32ZH1
  •   3  Database:DEF  DEF343

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF343    From 1 To 83 E-value: 2.8026e-45 Score: 172
        MRLLLMALPLLALLPQVIPDYSAEKRCLNRLGHCKRKCKAGEMVMETCKYFQVCCVLDDNDYKQKASITRTMEKTSTIEYNLS
  • 2. L12A01274|    From 1 To 64 E-value: 2e-34 Score: 135
        DYSAEKRCLNRLGHCKRKCKAGEMVMETCKYFQVCCVLDDNDYKQKASITRTMEKTSTIEYNLS
  • 3. L12A05872|    From 1 To 71 E-value: 6e-18 Score: 81.3
        LLPQVTPDYGAKKRCLKILGHCRRHCKDGEMDHGSCKYYRVCCVPDLNSYNQNYAITWTTEETSTSEYDLS
  • 4. L12A01270|    From 1 To 64 E-value: 0.00000000000006 Score: 67.8
        DYGAKKRCLKILGHCRRHCKDGEMDHGSCKYYRVCCVPDLNSYNQNYAITWTTEETSTSEYDLS
  • 5. L01A003498    From 2 To 43 E-value: 0.0000000003 Score: 55.5
        YGGEKKCWNRSGHCRKQCKDGEAVKETCKNHRACCVPSNEDH

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Sodergren E.J.,Muzny D.M.,Metzker M.L.,Weinstock G.M.,Gibbs R.A.,
  •   Title:Genome sequence of the Brown Norway rat yields insights into mammalian evolution.
  •   Journal:Nature, 2004, 428, 493-521  [PubMed:15057822]
  •   [2]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]
  •   [3]  Yao A.,Turner R.,Miller J.,Di Francesco V.,Florea L.,
  •   Title:Gene and alternative splicing annotation with AIR.
  •   Journal:Genome Res., 2005, 15, 54-66  [PubMed:15632090]
  •   [4]  French F.S.,Radhakrishnan Y.,Wingard C.J.,Chintalgattu V.,Yenugu S.,
  •   Title:Identification, cloning and functional characterization of novel beta-defensins in the rat (Rattus norvegicus).
  •   Journal:Reprod. Biol. Endocrinol., 2006, 4, 7-7  [PubMed:16457734]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: