Record in detail


General Info

  • lamp_id:L05ADEF358
  • Name:Q32ZF0_RAT
  • FullName:
  • Source:Rattus norvegicus
  • Mass:6953.3 Da
  • Sequence Length:62 aa
  • Isoelectric Point:9.7
  • Activity:Antimicrobial
  • Sequence
        MRIHAFLALLAIFQVLHAITSALNFQRPCYLRGGICLKQGTPNCEPFRGPCRAFTVCCKIRS
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:DRAMP  DRAMP03457
  •   2  Database:Uniprot  Q32ZF0
  •   3  Database:DEF  DEF358

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF358    From 1 To 62 E-value: 4e-32 Score: 128
        MRIHAFLALLAIFQVLHAITSALNFQRPCYLRGGICLKQGTPNCEPFRGPCRAFTVCCKIRS
  • 2. L03A000257    From 10 To 61 E-value: 0.15 Score: 26.6
        FILLLA--QGAAGSSLALGKREKCLRRNGFCAFLKCPTLSVISGTCSRFQVCCK
  • 3. L01A003612    From 8 To 42 E-value: 0.27 Score: 25.8
        RPCEKMGGICKSQKTHGCSILPAECKSRYKHCCRL
  • 4. L12A09056|    From 22 To 61 E-value: 0.45 Score: 25
        SQALGRKSDCFRKSGFCASLKCPYLTLISGKCSRFHLCCK
  • 5. L12A08015|    From 1 To 61 E-value: 0.47 Score: 25
        MKLHSLISVLLLFVTLIPKGKTGVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Sodergren E.J.,Muzny D.M.,Metzker M.L.,Weinstock G.M.,Gibbs R.A.,
  •   Title:Genome sequence of the Brown Norway rat yields insights into mammalian evolution.
  •   Journal:Nature, 2004, 428, 493-521  [PubMed:15057822]
  •   [2]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]
  •   [3]  Yao A.,Turner R.,Miller J.,Di Francesco V.,Florea L.,
  •   Title:Gene and alternative splicing annotation with AIR.
  •   Journal:Genome Res., 2005, 15, 54-66  [PubMed:15632090]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: