Record in detail


General Info

  • lamp_id:L05ADEF385
  • Name:Q0W9Q3_HORSE
  • FullName:
  • Source:Equus caballus
  • Mass:6979.4 Da
  • Sequence Length:62 aa
  • Isoelectric Point:9.28
  • Activity:Antimicrobial
  • Sequence
        MRLLFLLFLLLVCLIQMASGHEKTGRKHECQNMGGACKHQKTHGCAILPADCKSRNKHCCRV
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:DRAMP  DRAMP04479
  •   2  Database:Uniprot  Q0W9Q3
  •   3  Database:DEF  DEF385

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF385    From 1 To 62 E-value: 9e-32 Score: 127
        MRLLFLLFLLLVCLIQMASGHEKTGRKHECQNMGGACKHQKTHGCAILPADCKSRNKHCCRV
  • 2. L05ADEF386    From 1 To 62 E-value: 6e-19 Score: 84.3
        MRLLFLLFLLLVCLVQMTSGREKRRKSLECERMGGVCKHQKTHGCSILPAECKSRNKHCCRV
  • 3. L01A003605    From 9 To 42 E-value: 0.00000000002 Score: 59.3
        QCEKMGGICKYQKTHGCSILPAECKSRYKHCCRL
  • 4. L01A003612    From 10 To 42 E-value: 0.00000000009 Score: 57.4
        CEKMGGICKSQKTHGCSILPAECKSRYKHCCRL
  • 5. L03A000257    From 1 To 62 E-value: 0.002 Score: 33.1
        MRIVYLLFPFILLLAQGAAGSSLALGKREKCLRRNGFCAFLKCPTLSVISGTC-SRFQVCCKT

Structure

  •   Domains
  •   1  Name:Defensin_3    Interpro Link:IPR012553
  •   2  Name:Myo_neuro_toxin    Interpro Link:IPR023355
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Kuiper H.,Regenhard P.,Philipp U.,Paul S.,Looft C.,
  •   Title:Sequence analysis of a 212 kb defensin gene cluster on ECA 27q17.
  •   Journal:Gene, 2006, 376, 192-198  [PubMed:16723195]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: