Record in detail


General Info

  • lamp_id:L05ADEF393
  • Name:DEF2_APIME
  • FullName:Defensin-2
  • Source:Apis mellifera
  • Mass:4808.6 Da
  • Sequence Length:43 aa
  • Isoelectric Point:9.85
  • Activity:Antimicrobial
  • Sequence
        VTCDVLSWQSKWLSINHSACAIRCLAQRRKGGSCRNGVCICRK
  • Function:Antibacterial peptide mostly active against Gram-positive bacteria (By similarity).

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q5MQL3
  •   2  Database:DEF  DEF393

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A11296|    From 43 To 85 E-value: 7e-21 Score: 90.9
        VTCDVLSWQSKWLSINHSACAIRCLAQRRKGGSCRNGVCICRK
  • 2. L05ADEF393    From 1 To 43 E-value: 1e-19 Score: 87
        VTCDVLSWQSKWLSINHSACAIRCLAQRRKGGSCRNGVCICRK
  • 3. L05ADEF552    From 1 To 42 E-value: 0.000000000000004 Score: 72
        FSCDVLSFQSKWVSPNHSACAVRCLAQRRKGGKCKNGDCVCR
  • 4. L05ADEF539    From 1 To 43 E-value: 0.00000000000006 Score: 67.8
        VTCDVLSFEAKGIAVNHSACALHCIALRKKGGSCQNGVCVCRN
  • 5. L11A010673    From 1 To 42 E-value: 0.000000000001 Score: 63.5
        VTCDVLSFEAKGIAVNHSACALHAIALRKKGGSCQNGVCVAR

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Simuth J.,Kopernicky J.,Bachanova K.,Albert S.,Klaudiny J.,
  •   Title:Two structurally different defensin genes, one of them encoding a novel defensin isoform, are expressed in honeybee Apis mellifera.
  •   Journal:Insect Biochem. Mol. Biol., 2005, 35, 11-22  [PubMed:15607651]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: