Record in detail


General Info

  • lamp_id:L05ADEF403
  • Name:A4VBA2_ERITN
  • FullName:
  • Source:Eristalis tenax
  • Mass:4324 Da
  • Sequence Length:40 aa
  • Isoelectric Point:8.62
  • Activity:Antimicrobial
  • Sequence
        ATCDLLSFLNVKDAACAAHCLAKGYRGGYCDGRKVCNCRR
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:DRAMP  DRAMP04419
  •   2  Database:Uniprot  A4VBA2
  •   3  Database:DEF  DEF403

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF403    From 1 To 40 E-value: 5e-18 Score: 81.3
        ATCDLLSFLNVKDAACAAHCLAKGYRGGYCDGRKVCNCRR
  • 2. L03A000005    From 1 To 39 E-value: 0.000000000000001 Score: 73.6
        ATCDLLSFLNVNHAACAAHCLSKGYRGGYCDGKKVCNCR
  • 3. L11A013462    From 1 To 40 E-value: 0.00000000002 Score: 59.7
        ATCDLLSPFKVGHAACALHCIAMGRRGGWCDGRAVCNCRR
  • 4. L12A09191|    From 59 To 98 E-value: 0.00000000003 Score: 58.9
        ATCDLLSAFGVGHAACAAHCIGHGYRGGYCNSKAVCTCRR
  • 5. L05ADEF506    From 1 To 39 E-value: 0.00000000003 Score: 58.9
        ATCDLLSGLGVNDSACAAHCIARGNRGGYCNSKKVCVCR

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Vilcinskas A.,Altincicek B.,
  •   Title:Analysis of the immune-inducible transcriptome from microbial stress resistant, rat-tailed maggots of the drone fly Eristalis tenax.
  •   Journal:BMC Genomics, 2007, 8, 326-326  [PubMed:17875201]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: