Record in detail


General Info

  • lamp_id:L05ADEF405
  • Name:Q45RF8_BOMMO
  • FullName:
  • Source:Bombyx mori
  • Mass:4032.5 Da
  • Sequence Length:36 aa
  • Isoelectric Point:4.02
  • Activity:Antimicrobial
  • Sequence
        IWCEFEEATETAICQEHCLPKGYSYGICVSNTCSCI
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:DRAMP  DRAMP04439
  •   2  Database:Uniprot  Q45RF8
  •   3  Database:DEF  DEF405

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF405    From 1 To 36 E-value: 4e-16 Score: 75.5
        IWCEFEEATETAICQEHCLPKGYSYGICVSNTCSCI
  • 2. L05ADEF542    From 64 To 99 E-value: 0.00000000000001 Score: 70.1
        IWCQYEEVTEDAICQEHCIPKGYSYGLCISNTCSCI
  • 3. L05ADEF540    From 1 To 36 E-value: 0.0000000000009 Score: 63.9
        VSCDFEEANEDAVCQEHCLPKGYTYGICVSHTCSCI
  • 4. L13A019158    From 3 To 36 E-value: 0.000000000001 Score: 63.5
        CDFEEANEDAVCQEHCLPKGYTYGICVSHTCSCI
  • 5. L11A009743    From 2 To 37 E-value: 0.00000000002 Score: 59.3
        IPCQYEDATEDTICQQHCLPKGYSYGICVSYRCSCV

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Shiomi K.,He N.,Cheng T.,Lan X.,Wen H.,
  •   Title:Sequence structure and expression pattern of a novel anionic defensin-like gene from silkworm (Bombyx mori).
  •   Journal:Mol. Biol. Rep., 2009, 36, 711-716  [:]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: