Record in detail


General Info

  • lamp_id:L05ADEF408
  • Name:Q4VSK2_ANAPL
  • FullName:
  • Source:Anas platyrhynchos
  • Mass:4815.7 Da
  • Sequence Length:42 aa
  • Isoelectric Point:8.64
  • Activity:Antimicrobial
  • Sequence
        LPQRDMFLCRIGSCHFGRCPIHLVRVGSCFGFRSCCKSPWDV
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q4VSK2
  •   2  Database:DEF  DEF408

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A000198    From 23 To 64 E-value: 1e-20 Score: 90.1
        LPQRDMFLCRIGSCHFGRCPIHLVRVGSCFGFRSCCKSPWDV
  • 2. L05ADEF408    From 1 To 42 E-value: 5e-20 Score: 88.2
        LPQRDMFLCRIGSCHFGRCPIHLVRVGSCFGFRSCCKSPWDV
  • 3. L12A09044|    From 23 To 64 E-value: 2e-19 Score: 86.3
        LPQRDMFLCRKGSCHFGRCPIHLIRVGSCFGFRSCCKSPWDV
  • 4. L12A09041|    From 24 To 64 E-value: 4e-19 Score: 85.1
        PQRDMFLCRKGSCHFGRCPIHLVRVGSCFGFRSCCKSPWDV
  • 5. L12A09046|    From 23 To 64 E-value: 6e-19 Score: 84.7
        LPQRDMFLCRKGSCHFGRCPIHLVRVGSCFGFRSCCKLPWDV

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Sreekumar E.,Arathy D.S.,Soman S.S.,
  •   Title:Discovery of Anas platyrhynchos avian beta-defensin 2 (Apl_AvBD2) with antibacterial and chemotactic functions.
  •   Journal:Mol. Immunol., 2009, 46, 2029-2038  [PubMed:19362739]
  •   [2]  Niyas K.P.,Arathy D.S.,Issac A.,Nair S.,Soman S.S.,
  •   Title:Immunomodulation by duck defensin, Apl_AvBD2: in vitro dendritic cell immunoreceptor (DCIR) mRNA suppression, and B- and T-lymphocyte chemotaxis.
  •   Journal:Mol. Immunol., 2009, 46, 3070-3075  [PubMed:19577301]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: