Record in detail


General Info

  • lamp_id:L05ADEF410
  • Name:Q40779_PICAB
  • FullName:
  • Source:Picea abies
  • Mass:8835.3 Da
  • Sequence Length:83 aa
  • Isoelectric Point:8.6
  • Activity:Antimicrobial
  • Sequence
        MADKGVGSRLSAIFLLVLLVISIGMMQLELAEGRTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVANRKCYCSKPCP
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:DRAMP  DRAMP04448
  •   2  Database:Uniprot  Q40779
  •   3  Database:DEF  DEF410

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF410    From 1 To 83 E-value: 5.60519e-45 Score: 171
        MADKGVGSRLSAIFLLVLLVISIGMMQLELAEGRTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVANRKCYCSKPCP
  • 2. L05ADEF317    From 1 To 83 E-value: 3e-37 Score: 145
        MADKGVGSRLSALFLLVLLVISIGMMQLEPAEGRTCKTPSGKFKGVCASRNNCKNVCQTEGFPSGSCDFHVANRKCYCSKPCP
  • 3. L03A000077    From 1 To 83 E-value: 5e-37 Score: 144
        MADKGVCSRLSALFLLVLLVISIGMMQLELAEARTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVANRKCYCSKPCP
  • 4. L12A06219|    From 1 To 83 E-value: 3e-31 Score: 125
        MAGKGVGSRLSTLFLLVLLVITIGMMQVQVAEGRMCKTPSGKFKGYCVNNTNCKNVCRTEGFPTGSCDFHVAGRKCYCYKPCP
  • 5. L02A001553    From 1 To 50 E-value: 2e-20 Score: 89.4
        RMCKTPSGKFKGYCVNNTNCKNVCRTEGFPTGSCDFHVAGRKCYCYKPCP

Structure

  •   Domains
  •   1  Name:G_Purothionin    Interpro Link:IPR008177
  •   2  Name:Gamma-thionin    Interpro Link:IPR008176
  •   3  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Lonneborg A.,Sharma P.,
  •   Title:Isolation and characterization of a cDNA encoding a plant defensin-like protein from roots of Norway spruce.
  •   Journal:Plant Mol. Biol., 1996, 31, 707-712  [MEDLINE:96382440]
  •   [2]  Olsson O.,Clapham D.,Swedjemark G.,Fossdal C.G.,Elfstrand M.,
  •   Title:Identification of candidate genes for use in molecular breeding - A case study with the Norway spruce defensin-like gene, spi1.
  •   Journal:Silvae Genet., 2001, 50, 45-92  [AGRICOLA:IND23246332]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: