Record in detail


General Info

  • lamp_id:L05ADEF413
  • Name:DFP6_LONON
  • FullName:Defense protein 6
  • Source:Lonomia obliqua
  • Mass:4612.2 Da
  • Sequence Length:43 aa
  • Isoelectric Point:8.63
  • Activity:Antimicrobial
  • Sequence
        LTVRAAQSFGRCNQKQCDADCVKKGYFGGLCTLTSCFCTGSRS
  • Function:Has antibacterial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF413    From 1 To 43 E-value: 7e-20 Score: 87.4
        LTVRAAQSFGRCNQKQCDADCVKKGYFGGLCTLTSCFCTGSRS
  • 2. L12A07775|    From 25 To 51 E-value: 0.027 Score: 29.3
        CNDRDCSLDCIMKGYNTGSCVRGSCQC
  • 3. L01A000575    From 16 To 41 E-value: 0.041 Score: 28.5
        NHAGCALHCVIKGYKGGQCKITVCHC
  • 4. L05ADEF261    From 3 To 30 E-value: 0.1 Score: 27.3
        CTNPTCSAQCRGRGYRRGSCTIGRCFCS
  • 5. L11A009206    From 17 To 55 E-value: 0.18 Score: 26.6
        VTITVKPPFPGCVFYECIANCRSRGYKNGGYCTINGCQC

Structure

  •   Domains
  •   1  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Francischetti I.M.B.,Guimaraes J.A.,Ribeiro J.M.C.,Veiga A.B.G.,
  •   Title:A catalog for the transcripts from the venomous structures of the caterpillar Lonomia obliqua: identification of the proteins potentially involved in the coagulation disorder and hemorrhagic syndrome.
  •   Journal:Gene, 2005, 355, 11-27  [PubMed:16023793]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: