Record in detail


General Info

  • lamp_id:L05ADEF415
  • Name:B9UKC7_APICC
  • FullName:
  • Source:Apis cerana cerana
  • Mass:5578.4 Da
  • Sequence Length:51 aa
  • Isoelectric Point:8.63
  • Activity:Antimicrobial
  • Sequence
        VTCDLLSFKGQVNDSACAANCFSLGKAGGHCKNGVCICRKTSFKDFWDKRF
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  B9UKC7
  •   2  Database:DEF  DEF415

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF415    From 1 To 51 E-value: 5e-25 Score: 104
        VTCDLLSFKGQVNDSACAANCFSLGKAGGHCKNGVCICRKTSFKDFWDKRF
  • 2. L05ADEF560    From 1 To 51 E-value: 2e-24 Score: 102
        VTCDLLSFKGQVNDSACAANCLSLGKAGGHCKNGVCICRKTSFKDFWDKRF
  • 3. L05ADEF559    From 1 To 51 E-value: 2e-24 Score: 102
        VTCDLLSFKGQVNDSACAANCFSLGKAGGHCKNGVCICRKTSFKDLWDKRF
  • 4. L05ADEF557    From 1 To 51 E-value: 4e-24 Score: 101
        VTCDLLSFKGQVNDSACAANCLSLGKAGGHCKNGVCICRKTSFKDLWDKRF
  • 5. L12A07935|    From 44 To 94 E-value: 5e-24 Score: 101
        VTCDLLSFKGQVNDSACAANCLSLGKAGGHCEKGVCICRKTSFKDLWDKRF

Structure

  •   Domains
  •   1  Name:Defensin_insect    Interpro Link:IPR017982
  •   2  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   3  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Chen X.X.,Xu P.,
  •   Title:Molecular cloning of antimicrobial peptide genes of Chinese honeybee (Apis cerana cerana Fabricius) and comparison with Italian honeybee (Apis mellifera L.).
  •   Journal:PLoS ONE, 2009, 4, 0-0  [:]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: