Record in detail


General Info

  • lamp_id:L05ADEF423
  • Name:Q5SDH6_9NEOP
  • FullName:
  • Source:Drepanotermes rubriceps
  • Mass:4335.9 Da
  • Sequence Length:37 aa
  • Isoelectric Point:9.8
  • Activity:Antimicrobial
  • Sequence
        ACNRNACWASCQRQHGIYFRRAFCEGSRCRCVRVNGR
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q5SDH6
  •   2  Database:DEF  DEF423

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF423    From 1 To 37 E-value: 4e-16 Score: 75.1
        ACNRNACWASCQRQHGIYFRRAFCEGSRCRCVRVNGR
  • 2. L05ADEF422    From 2 To 37 E-value: 0.000000000002 Score: 62.8
        CNTKACWALCQREHGIYFRRAVCEGSRCKCILVNGR
  • 3. L05ADEF431    From 1 To 36 E-value: 0.0000000007 Score: 54.3
        ACDFQSCWVTCQRQHSIYFIRAFCDGSRCMCVYNNG
  • 4. L01A002498    From 6 To 41 E-value: 0.000000001 Score: 53.5
        ACNFQSCWATCQAQHSIYFRRAFCDRSQCKCVFVRG
  • 5. L01A000154    From 1 To 36 E-value: 0.000000001 Score: 53.1
        ACNFQSCWATCQAQHSIYFRRAFCDRSQCKCVFVRG

Structure

  •   Domains
  •   1  Name:Termicin    Interpro Link:IPR024723
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Crozier R.H.,Bulmer M.S.,
  •   Title:Duplication and diversifying selection among termite antifungal peptides.
  •   Journal:Mol. Biol. Evol., 2004, 21, 2256-2264  [PubMed:15317879]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: