Record in detail


General Info

  • lamp_id:L05ADEF428
  • Name:Q5SDJ1_9NEOP
  • FullName:
  • Source:Nasutitermes exitiosus
  • Mass:4240.9 Da
  • Sequence Length:37 aa
  • Isoelectric Point:8.12
  • Activity:Antimicrobial
  • Sequence
        ACNFQSCWAICKAHYGIYFRRAYCDGPNCQCVHLIQG
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q5SDJ1
  •   2  Database:DEF  DEF428
  •   3  Database:DEF  DEF439

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF428    From 1 To 37 E-value: 1e-17 Score: 80.1
        ACNFQSCWAICKAHYGIYFRRAYCDGPNCQCVHLIQG
  • 2. L05ADEF441    From 1 To 37 E-value: 4e-17 Score: 78.6
        ACNFQSCWAICKEHYGIYFRRAYCDGPNCQCVHLIQG
  • 3. L05ADEF438    From 1 To 36 E-value: 3e-16 Score: 75.5
        ACNFQSCWATCKAHYGIYFRRAYCDGPNCQCVHLTQ
  • 4. L05ADEF434    From 1 To 37 E-value: 0.00000000003 Score: 59.3
        ACDFHSCWATCQAQHGICFRRAYCDGPSCQCVFLNQG
  • 5. L05ADEF425    From 1 To 37 E-value: 0.00000000005 Score: 58.2
        ACDFNSCWATCKAQNGIYFRRAFCDGPTCLCVFLNAG

Structure

  •   Domains
  •   1  Name:Termicin    Interpro Link:IPR024723
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Crozier R.H.,Bulmer M.S.,
  •   Title:Duplication and diversifying selection among termite antifungal peptides.
  •   Journal:Mol. Biol. Evol., 2004, 21, 2256-2264  [PubMed:15317879]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: