Record in detail


General Info

  • lamp_id:L05ADEF457
  • Name:A4FSG3_9INSE
  • FullName:
  • Source:Thermobia domestica
  • Mass:4689.5 Da
  • Sequence Length:43 aa
  • Isoelectric Point:9.79
  • Activity:Antimicrobial
  • Sequence
        VTCDLLSFSSKIFSFNHSACAAHCLAKRKKGGRCVNGVCRCRN
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  A4FSG3
  •   2  Database:DEF  DEF457

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF457    From 1 To 43 E-value: 1e-19 Score: 87
        VTCDLLSFSSKIFSFNHSACAAHCLAKRKKGGRCVNGVCRCRN
  • 2. L12A11296|    From 43 To 84 E-value: 0.000000000001 Score: 63.5
        VTCDVLSWQSKWLSINHSACAIRCLAQRRKGGSCRNGVCICR
  • 3. L05ADEF539    From 1 To 43 E-value: 0.000000000001 Score: 63.2
        VTCDVLSFEAKGIAVNHSACALHCIALRKKGGSCQNGVCVCRN
  • 4. L01A000074    From 2 To 43 E-value: 0.000000000001 Score: 63.2
        TCDALSFSSKWLTVNHSACAIHCLTKGYKGGRCVNTICNCRN
  • 5. L01A002834    From 1 To 43 E-value: 0.000000000002 Score: 62.8
        VTCDLLSFEAKGFAANHSICAAHCLAIGRKGGSCQNGVCVCRN

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Vilcinskas A.,Altincicek B.,
  •   Title:Identification of immune-related genes from an apterygote insect, the firebrat Thermobia domestica.
  •   Journal:Insect Biochem. Mol. Biol., 2007, 37, 726-731  [PubMed:17550828]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: