Record in detail


General Info

  • lamp_id:L05ADEF468
  • Name:Q4WGI8_ASPFU
  • FullName:
  • Source:Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100)
  • Mass:3971.4 Da
  • Sequence Length:38 aa
  • Isoelectric Point:4.49
  • Activity:Antimicrobial
  • Sequence
        SICCSFPDPWGGLCCEDHCSYIGKPGGQCSDKGVCTCN
  • Function:The sequence shown here is derived from an EMBL/GenBank/DDBJ whole genome shotgun (WGS) entry which is preliminary data.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q4WGI8
  •   2  Database:DEF  DEF468

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A011983    From 2 To 39 E-value: 3e-17 Score: 79
        SICCSFPDPWGGLCCEDHCSYIGKPGGQCSDKGVCTCN
  • 2. L05ADEF468    From 1 To 38 E-value: 3e-17 Score: 78.6
        SICCSFPDPWGGLCCEDHCSYIGKPGGQCSDKGVCTCN
  • 3. L05ADEF476    From 1 To 38 E-value: 1e-16 Score: 77
        SICCSFPDPWGGLCCEDHCSYIGKPGGQCSDKSVCTCN
  • 4. L05ADEF478    From 1 To 38 E-value: 3e-16 Score: 75.5
        SICCSFPDPWGGFCCEDHCSYIGKPGGQCSDKKVCTCN
  • 5. L05ADEF472    From 1 To 38 E-value: 0.0000000000002 Score: 66.2
        SISCNFPDPFGGLICENHCAYIGKPGGQCSDQKVCTCN

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Kim H.S.,Wortman J.R.,Anderson M.J.,Pain A.,Nierman W.C.,
  •   Title:Genomic sequence of the pathogenic and allergenic filamentous fungus Aspergillus fumigatus.
  •   Journal:Nature, 2005, 438, 1151-1156  [PubMed:16372009]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: