Record in detail


General Info

  • lamp_id:L05ADEF469
  • Name:Q2GWM6_CHAGB
  • FullName:
  • Source:Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
  • Mass:5030.7 Da
  • Sequence Length:50 aa
  • Isoelectric Point:4.82
  • Activity:Antimicrobial
  • Sequence
        QDCSSVVCVLGDGACNRVCEMEGHTEGGKCVPRDGCPAGSEICVCGAKKA
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q2GWM6
  •   2  Database:DEF  DEF469

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF469    From 1 To 50 E-value: 2e-23 Score: 99.4
        QDCSSVVCVLGDGACNRVCEMEGHTEGGKCVPRDGCPAGSEICVCGAKKA
  • 2. L05ADEF477    From 4 To 49 E-value: 0.0000003 Score: 45.4
        NSISCALGGDNVCNNVCVRQGNDNGGRCLPRDGCP-GYDICACYPRS
  • 3. L05ADEF473    From 4 To 45 E-value: 0.0000003 Score: 45.4
        NSISCALGGDSTCNNVCVRQGNPHGGRCLPRDGCP-GYDICAC
  • 4. L05ADEF467    From 4 To 45 E-value: 0.0000004 Score: 45.4
        NSISCMMGGDSTCNNVCVRQGNPNGGRCLPRDGCP-GYDICAC
  • 5. L05ADEF475    From 4 To 45 E-value: 0.0000004 Score: 45.1
        NSISCMMGGDSTCNNVCVRQGNPSGGRCLPRDGCP-GYDICAC

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: