Record in detail


General Info

  • lamp_id:L05ADEF472
  • Name:Q2UP63_ASPOR
  • FullName:
  • Source:Aspergillus oryzae (strain ATCC 42149 / RIB 40)
  • Mass:4007.5 Da
  • Sequence Length:38 aa
  • Isoelectric Point:5.51
  • Activity:Antimicrobial
  • Sequence
        SISCNFPDPFGGLICENHCAYIGKPGGQCSDQKVCTCN
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q2UP63
  •   2  Database:DEF  DEF472
  •   3  Database:DEF  DEF480

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF472    From 1 To 38 E-value: 1e-17 Score: 80.5
        SISCNFPDPFGGLICENHCAYIGKPGGQCSDQKVCTCN
  • 2. L05ADEF478    From 1 To 38 E-value: 0.0000000000001 Score: 67.4
        SICCSFPDPWGGFCCEDHCSYIGKPGGQCSDKKVCTCN
  • 3. L05ADEF476    From 1 To 38 E-value: 0.0000000000001 Score: 67
        SICCSFPDPWGGLCCEDHCSYIGKPGGQCSDKSVCTCN
  • 4. L11A011983    From 2 To 39 E-value: 0.0000000000002 Score: 66.6
        SICCSFPDPWGGLCCEDHCSYIGKPGGQCSDKGVCTCN
  • 5. L05ADEF468    From 1 To 38 E-value: 0.0000000000002 Score: 66.2
        SICCSFPDPWGGLCCEDHCSYIGKPGGQCSDKGVCTCN

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Kumagai T.,Tanaka T.,Sano M.,Asai K.,Machida M.,
  •   Title:Genome sequencing and analysis of Aspergillus oryzae.
  •   Journal:Nature, 2005, 438, 1157-1161  [PubMed:16372010]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: