Record in detail


General Info

  • lamp_id:L05ADEF495
  • Name:Q6YC89_DERVA
  • FullName:
  • Source:Dermacentor variabilis
  • Mass:3223.6 Da
  • Sequence Length:32 aa
  • Isoelectric Point:7.73
  • Activity:Antimicrobial
  • Sequence
        ASGCKADACKSYCKSLGSGGGYCDQGTWCVCN
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:DRAMP  DRAMP04413
  •   2  Database:Uniprot  Q6YC89
  •   3  Database:DEF  DEF495

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF495    From 1 To 32 E-value: 0.0000000000008 Score: 64.3
        ASGCKADACKSYCKSLGSGGGYCDQGTWCVCN
  • 2. L11A008178    From 8 To 39 E-value: 0.033 Score: 28.9
        ATGFSGTACAAHCLLIGHRGGYCNTKSVCVCR
  • 3. L05ADEF465    From 3 To 32 E-value: 0.05 Score: 28.5
        GCPNDYACSSYCSSIGRNGGYCGGFLWQTC
  • 4. L01A002932    From 19 To 43 E-value: 0.051 Score: 28.1
        ACGAHCLALGRTGGYCNSKSVCVCR
  • 5. L01A002931    From 19 To 43 E-value: 0.054 Score: 28.1
        ACGAHCLALGRRGGYCNSKSVCVCR

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Azad A.F.,Rahman M.S.,Gillespie J.J.,Dreher-Lesnick S.M.,Ceraul S.M.,
  •   Title:New tick defensin isoform and antimicrobial gene expression in response to Rickettsia montanensis challenge.
  •   Journal:Infect. Immun., 2007, 75, 1973-1983  [PubMed:17261604]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: