Record in detail


General Info

  • lamp_id:L05ADEF498
  • Name:Q7YXK5_IXORI
  • FullName:
  • Source:Ixodes ricinus
  • Mass:4497.3 Da
  • Sequence Length:39 aa
  • Isoelectric Point:9.44
  • Activity:Antimicrobial
  • Sequence
        GGYYCPFFQDKCHRHCRSFGRKAGYCGGFLKKTCICVMK
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:DRAMP  DRAMP04495
  •   2  Database:Uniprot  Q7YXK5
  •   3  Database:DEF  DEF498

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002628    From 38 To 76 E-value: 3e-19 Score: 85.5
        GGYYCPFFQDKCHRHCRSFGRKAGYCGGFLKKTCICVMK
  • 2. L05ADEF498    From 1 To 39 E-value: 7e-18 Score: 80.9
        GGYYCPFFQDKCHRHCRSFGRKAGYCGGFLKKTCICVMK
  • 3. L01A002645    From 38 To 74 E-value: 4e-17 Score: 78.6
        GGYYCPFRQDKCHRHCRSFGRKAGYCGGFLKKTCICV
  • 4. L02A001754    From 1 To 37 E-value: 1e-16 Score: 77
        GGYYCPFFQDKCHRHCRSFGRKAGYCGGFLKKTCICV
  • 5. L02A001755    From 1 To 37 E-value: 8e-16 Score: 74.3
        GGYYCPFRQDKCHRHCRSFGRKAGYCGGFLKKTCICV

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Grubhoffer L.,Edwards M.J.,Golovchenko M.,Rudenko N.,
  •   Title:Differential expression of Ixodes ricinus tick genes induced by blood feeding or Borrelia burgdorferi infection.
  •   Journal:J. Med. Entomol., 2005, 42, 36-41  [PubMed:15691006]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: